KEGG   Enterobacteriaceae bacterium ENNIH2: C2U52_28650Help
Entry
C2U52_28650       CDS       T05417                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ebc  Enterobacteriaceae bacterium ENNIH2
Pathway
ebc00020  Citrate cycle (TCA cycle)
ebc00190  Oxidative phosphorylation
ebc00650  Butanoate metabolism
ebc01100  Metabolic pathways
ebc01110  Biosynthesis of secondary metabolites
ebc01120  Microbial metabolism in diverse environments
ebc01130  Biosynthesis of antibiotics
ebc01200  Carbon metabolism
Module
ebc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ebc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ebc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C2U52_28650
   00650 Butanoate metabolism
    C2U52_28650
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C2U52_28650
Enzymes [BR:ebc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C2U52_28650
    1.3.5.4  fumarate reductase (quinol)
     C2U52_28650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: AUV09941
UniProt: A0A2I8QUN7
LinkDB All DBs
Position
complement(5424946..5426712)
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNAQGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGVLRDASESDIEGSLERLNRWNNNRSGEDPVTIRKALQECMQHNFSVFREGDAM
AKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPERDDENWLCHSLYLPETESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccagtcagagaatttgatgctgtcgttattggcgcaggcggcgcaggtatg
cgcgcggcgttacaaatttcccaaagcggccagacctgtgcgctgctttctaaagttttt
ccaacccgttctcacactgtatccgctcagggcggcattacggtagcgctgggcaatacc
cacgaagataactgggaatggcacatgtacgatacggtaaaaggttccgattacatcggc
gaccaggatgccattgaatatatgtgtaaaaccggtccggaagccattctggaactggaa
catatgggcctgccgttttcgcgtctcgatgacggccgcatctaccagcgtccgttcggc
ggtcagtcaaaaaatttcggtggcgagcaggctgcacgtaccgcagcggcggctgaccgt
accgggcacgcgttattacatacgctttatcagcaaaaccttaaaaaccacactactatt
ttttccgagtggtacgcgctggatctggtgaaaaaccaggatggtgcagtcgtcggttgt
accgcgctgtgcattgaaaccggtgaagtggtttacttcaaagcccgtgcgaccgtactg
gcaacgggcggcgcgggtcgtatttaccagtccaccaccaacgcgcacatcaataccggc
gacggtgtcgggatggcgctgcgtgccggtgtgccggtgcaggatatggaaatgtggcag
ttccacccgaccggtatcgccggggcgggggtgctggtcaccgaaggttgccgcggtgaa
ggcggctatctcttaaacaaacatggtgagcgtttcatggagcgctatgcgccgaacgca
aaagacctggcgggtcgtgatgtggtggcacgttccatcatgatcgaaatccgtgaaggt
cgtggctgtgacggtccgtggggaccacacgccaaactgaaactcgaccacctcggtaaa
gaggtgctggagtcgcgtttgcctggcattctggagctgtcccgtacttttgcgcacgtc
gatcctgtaaaagagccgatcccggtgatcccaacttgtcactatatgatgggcgggatc
ccgaccaaagtgaccggtcaggcgctgacggtgaatgcgcagggcgaagatgtggtgatc
ccaggcctgttcgcagtgggcgaaattgcctgcgtatcggtgcacggtgccaaccgtctg
ggcggcaactctctgcttgaccttgtggtctttggtcgtgcggcaggtctgcatctgcaa
gagtctatcgctgagcagggcgtactgcgcgatgcgagtgaatctgacattgaaggttcg
ctggagcgtctcaaccgttggaacaacaaccgttcaggtgaagatccggtgaccattcgt
aaagcgttgcaggaatgtatgcaacataacttctcggtcttccgtgaaggcgacgcgatg
gcgaaaggtcttgagcaactgaaagtcattcgcgaacgcctgaaaaatgcccgtctggat
gacacctccagtgaatttaacacccagcgtgttgagtgcctggagctggataacctgatg
gaaaccgcgtacgcgacggcggtatctgccaacttccgtaccgagagccgtggcgcgcat
agccgcttcgacttcccggagcgtgatgatgaaaactggctgtgccattccctgtatctg
ccagagacggaatccatgacgcgccgtagcgtcaacatggaaccgaaactgcgtccggct
ttcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system