KEGG   Enterobacteriaceae bacterium ENNIH2: C2U52_28985Help
Entry
C2U52_28985       CDS       T05417                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ebc  Enterobacteriaceae bacterium ENNIH2
Pathway
ebc00550  Peptidoglycan biosynthesis
ebc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C2U52_28985
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ebc01002]
    C2U52_28985
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ebc01011]
    C2U52_28985
Enzymes [BR:ebc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     C2U52_28985
Peptidases and inhibitors [BR:ebc01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   C2U52_28985
Peptidoglycan biosynthesis and degradation proteins [BR:ebc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   C2U52_28985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AUV09995
UniProt: A0A2I8QVM4
LinkDB All DBs
Position
5487308..5488519
Genome map
AA seq 403 aa AA seqDB search
MKTTLSVRFVQRLALTTALTAATLGAAHADDLNIKTMIPGAPQIDAESWILIDYNSGKVL
TEQNADSRRDPASLTKMMTSYVIGQAMKAGKFKDSDLVTIGNDAWATGNPVFRGSSLMFL
KPGMQVPVSQLIRGINLQSGNDACVAMADYVAGSQDAFVGLMNNYVKALGLQNSHFQTVH
GLDAEGQYSSARDMALIGQALIRDVPNEYSIYKEKEFTFNGIRQTNRNGLLWDNSLNVDG
IKTGHTDKAGYNLVASATEGQMRLISAVMGGRTFKGREAESKKLLTWGFRFFETVSPLKA
GKEFASEPAWFGDNDRASLGVDKDVYLTIPRGRMKDLKASYVLSTSELHAPLQKNQVVGT
INFQLDGKTIEQRPLVVLQEIQEGNFFGKIIDYIKLMFHHWFG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccactctctccgttcgtttcgtacagcgcctggcgctcaccacggcactcact
gccgcaaccctcggcgcagcccatgccgatgatctcaacatcaagaccatgattcctggc
gccccacagattgatgccgaatcctggatcctcatcgattacaactccggcaaggtgttg
accgaacagaacgccgattcacgccgcgatccggccagcctgacgaaaatgatgaccagc
tacgtcatcggccaggcaatgaaagcgggtaaattcaaagacagcgatctggtcactatc
ggcaatgacgcatgggcgaccggcaacccggtgttccgtggctcttctctgatgttcctg
aaaccgggtatgcaagttccggtttcccagctcatccgtggtatcaacctgcagtctggt
aacgacgcctgtgtggcgatggccgattatgttgccggtagccaggacgcctttgtcggt
ctgatgaataactacgttaaagcgcttggcctgcagaactcccacttccagacggttcat
ggtctggatgcagagggtcaatacagctcagcgcgtgacatggctctgattggccaggca
ttgattcgtgatgtgccaaacgaatactccatctacaaagagaaagagttcacctttaac
ggtatccgccagaccaaccgtaacggcctgctgtgggataacagcctgaatgtcgacggt
attaaaacgggtcacacagacaaagcgggttacaacctggtggcttctgcaaccgaaggc
cagatgcgtctgatctccgcagtcatgggtggcagaacattcaaagggcgtgaggccgaa
agtaaaaaactgctgacatggggtttccgtttcttcgaaaccgtaagcccgctgaaagca
ggcaaagagttcgcctctgagccagcctggttcggtgataacgatcgcgcttcgttgggt
gttgataaagacgtatacctgacaatcccacgtggtcgcatgaaagacctgaaagcaagt
tatgttttaagcaccagcgaactgcacgcaccgttgcagaaaaatcaggtggttggcacg
attaacttccagttggacggcaaaaccatcgaacaacgccctctggtcgtgctgcaggaa
attcaggaagggaatttcttcggcaaaatcatcgactatatcaagctgatgttccaccac
tggttcggctaa

DBGET integrated database retrieval system