KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_0316Help
Entry
ECBD_0316         CDS       T00939                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00564  Glycerophospholipid metabolism
ebd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECBD_0316
Enzymes [BR:ebd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ECBD_0316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: ACT27391
UniProt: A0A140N6N1
LinkDB All DBs
Structure
PDB: 

Position
complement(346970..348475)
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKYSWQARGLVNATGPWVKQFFDDGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLNVYNTHF
KKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYART
YGSNSELLLGNAGTVSDLGEDFGHEFYEAELKYLVDHEWVRRADDALWRRTKQGMWLNAD
QQSRVSQWLVEYTQQRLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgatagggggcggcatcaatggtgctggtatcgcggca
gacgccgctggacgcggtttatccgtgctgatgctggaggcgcaggatctcgcttgcgcg
acctcttccgccagttcaaaactcattcacggtggcctgcgctaccttgagcactatgaa
ttccgcctggtcagcgaggcgctggctgaacgtgaagtgctgctgaaaatggccccgcat
atcgccttcccgatgcgttttcgcctgccacatcgtccgcatctgcgcccggcgtggatg
attcgcattggtctgtttatgtacgatcatctgggtaaacgcaccagcttgccgggatca
actggtttgcgttttggcgcaaattcagtgttaaaaccggaaattaagcgcggattcgaa
tattctgactgttgggtagacgacgcccgtctggtactcgccaacgcccagatggtggtg
cgtaaaggcggcgaagtgcttactcggactcgcgccacctctgctcgccgcgaaaacggc
ctgtggattgtggaagcggaagatatcgataccggcaaaaaatatagctggcaagcgcgc
ggcttggttaacgccaccggcccgtgggtgaaacagttcttcgacgacgggatgcatctg
ccttcgccttatggcattcgcctgatcaaaggcagccatattgtggtgccgcgcgtgcat
acccagaagcaagcctacattctgcaaaacgaagataaacgtattgtgttcgtgatcccg
tggatggacgagttttccatcatcggcactaccgatgtcgagtacaaaggcgatccgaaa
gcggtgaagattgaagagagtgaaatcaattacctgctgaatgtgtataacacgcacttt
aaaaagcagttaagccgtgacgatatcgtctggacctactccggtgtgcgtccgctgtgt
gatgatgagtccgactcgccgcaggctattacccgtgattacacccttgatattcatgat
gaaaatggcaaagcaccgctgctgtcggtattcggcggtaagctgaccacctaccgaaaa
ctggcggaacatgcgctggaaaaactaacgccgtattatcagggtattggcccggcatgg
acgaaagagagtgtgctaccgggtggcgccattgaaggcgaccgcgacgattatgccgct
cgcctgcgccgccgctatccgttcctgactgaatcgctggcgcgtcattacgctcgcact
tacggcagcaacagcgagctgctgctcggcaatgcgggaacggtaagcgatctcggggaa
gatttcggtcatgagttctacgaagcggagctgaaatacctggtggatcacgaatgggtc
cgccgcgccgacgacgccctgtggcgtcgcacaaaacaaggcatgtggctaaatgcggat
caacaatctcgtgtgagtcagtggctggtggagtatacgcagcagaggttatcgctggcg
tcgtaa

DBGET integrated database retrieval system