KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_0489Help
Entry
ECBD_0489         CDS       T00939                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00061  Fatty acid biosynthesis
ebd00620  Pyruvate metabolism
ebd00640  Propanoate metabolism
ebd01100  Metabolic pathways
ebd01110  Biosynthesis of secondary metabolites
ebd01120  Microbial metabolism in diverse environments
ebd01130  Biosynthesis of antibiotics
ebd01200  Carbon metabolism
ebd01212  Fatty acid metabolism
Module
ebd_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECBD_0489
   00640 Propanoate metabolism
    ECBD_0489
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ECBD_0489
Enzymes [BR:ebd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     ECBD_0489
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     ECBD_0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp_3 Dala_Dala_lig_C ATP-grasp GARS_A ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ACT27560
UniProt: A0A140N7J9
LinkDB All DBs
Structure
PDB: 

Position
complement(505382..506731)
Genome map
AA seq 449 aa AA seqDB search
MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSY
LNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKAETIRLMGDKVSAI
AAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIGYPVIIKASGGGGGRGMRVVRGDAELAQ
SISMTRAEAKAAFSNDMVYMEKYLENPRHVEIQVLADGQGNAIYLAERDCSMQRRHQKVV
EEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSIKQEEVHVRGHAVECRINAEDPNTFLPSPGKITRFHAP
GGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALQELIIDGIKTNVDL
QIRIMNDENFQHGGTNIHYLEKKLGLQEK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgctggataaaattgttattgccaaccgcggcgagattgcattgcgtattcttcgtgcc
tgtaaagaactgggcatcaagactgtcgctgtgcactccagcgcggatcgcgatctaaaa
cacgtattactggcagatgaaacggtctgtattggccctgctccgtcagtaaaaagttat
ctgaacatcccggcaatcatcagcgccgctgaaatcaccggcgcagtagcaatccatccg
ggttacggcttcctctccgagaacgccaactttgccgagcaggttgaacgctccggcttt
atcttcattggcccgaaagcagaaaccattcgcctgatgggcgacaaagtatccgcaatc
gcggcgatgaaaaaagcgggcgtcccttgcgtaccgggttctgacggcccgctgggcgac
gatatggataaaaaccgtgccattgctaaacgcattggttatccggtgattatcaaagcc
tccggcggcggcggcggtcgcggtatgcgcgtagtgcgcggcgacgctgaactggcacaa
tccatctccatgacccgtgcggaagcgaaagctgctttcagcaacgatatggtttacatg
gagaaatacctggaaaatcctcgccacgtcgagattcaggtactggctgacggtcagggc
aacgctatctatctggcggaacgtgactgctccatgcaacgccgccaccagaaagtggtc
gaagaagcgccagcaccgggcattaccccggaactgcgtcgctacatcggcgaacgttgc
gctaaagcgtgtgttgatatcggctatcgcggtgcaggtactttcgagttcctgttcgaa
aacggcgagttctatttcatcgaaatgaacacccgtattcaggtagaacacccggttaca
gaaatgatcaccggcgttgacctgatcaaagaacagctgcgtatcgctgccggtcaaccg
ctgtcgatcaagcaagaagaagttcacgttcgcggccatgcggtggaatgtcgtatcaac
gccgaagatccgaacaccttcctgccaagtccgggcaaaatcacccgtttccacgcacct
ggcggttttggcgtacgttgggagtctcatatctacgcgggctacaccgtaccgccgtac
tatgactcaatgatcggtaagctgatttgctacggtgaaaaccgtgacgtggcgattgcc
cgcatgaagaatgcgctgcaggagctgatcatcgacggtatcaaaaccaacgttgatctg
cagatccgcatcatgaatgacgagaacttccagcatggtggcactaacatccactatctg
gagaaaaaactcggtcttcaggaaaaataa

DBGET integrated database retrieval system