KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_1057Help
Entry
ECBD_1057         CDS       T00939                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00250  Alanine, aspartate and glutamate metabolism
ebd00280  Valine, leucine and isoleucine degradation
ebd00310  Lysine degradation
ebd00410  beta-Alanine metabolism
ebd00640  Propanoate metabolism
ebd00650  Butanoate metabolism
ebd01100  Metabolic pathways
ebd01120  Microbial metabolism in diverse environments
Module
ebd_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECBD_1057
   00650 Butanoate metabolism
    ECBD_1057
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECBD_1057
   00280 Valine, leucine and isoleucine degradation
    ECBD_1057
   00310 Lysine degradation
    ECBD_1057
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECBD_1057
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ebd01007]
    ECBD_1057
Enzymes [BR:ebd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECBD_1057
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ECBD_1057
    2.6.1.48  5-aminovalerate transaminase
     ECBD_1057
Amino acid related enzymes [BR:ebd01007]
 Aminotransferase (transaminase)
  Class III
   ECBD_1057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACT28123
UniProt: A0A140N7B3
LinkDB All DBs
Structure
PDB: 

Position
complement(1106102..1107382)
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHSKPDAKLTAGIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggtgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacttgcatccg
aaagtggtggctgcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcctacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccgggcgat
ttcgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtaaaa
atcgcccgcgccgccaccaaacgtagcggcaccatcgcttttagcggcgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcataagcgag
gatgacgctatcgccagcatccaccggatcttcaaaaatgatgccgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctacgccgcgtcgccagcc
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcagatgggcgttgcg
ccggatctcaccacctttgcgaaatcgatcgcgggcggcttcccgctggcgggcgtcacc
gggcgcgcggaagtgatggatgccgtcgctccaggtggtctgggcggcacctatgccggt
aacccgattgcctgcgtggcggcgctggaagtgttgaaggtgtttgagcaggaaaatctg
ctgcaaaaagccaacgatctggggcagaagctaaaagacggattgttagcgatagccgaa
aaacacccggagatcggcgacgtacgcgggctgggagcgatgatcgccatcgagctgttt
gaagatggcgatcacagcaaaccggacgcaaaactcaccgccgggatcgtggcgcgcgcc
cgcgataaaggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgctgaggcgaagcagtag

DBGET integrated database retrieval system