KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_1319Help
Entry
ECBD_1319         CDS       T00939                                 

Definition
(GenBank) fatty acid oxidation complex, alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00071  Fatty acid degradation
ebd00280  Valine, leucine and isoleucine degradation
ebd00281  Geraniol degradation
ebd00310  Lysine degradation
ebd00362  Benzoate degradation
ebd00380  Tryptophan metabolism
ebd00410  beta-Alanine metabolism
ebd00640  Propanoate metabolism
ebd00650  Butanoate metabolism
ebd00903  Limonene and pinene degradation
ebd00930  Caprolactam degradation
ebd01100  Metabolic pathways
ebd01110  Biosynthesis of secondary metabolites
ebd01120  Microbial metabolism in diverse environments
ebd01130  Biosynthesis of antibiotics
ebd01200  Carbon metabolism
ebd01212  Fatty acid metabolism
Module
ebd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECBD_1319
   00650 Butanoate metabolism
    ECBD_1319
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ECBD_1319
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECBD_1319
   00310 Lysine degradation
    ECBD_1319
   00380 Tryptophan metabolism
    ECBD_1319
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECBD_1319
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECBD_1319
   00281 Geraniol degradation
    ECBD_1319
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECBD_1319
   00930 Caprolactam degradation
    ECBD_1319
Enzymes [BR:ebd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ECBD_1319
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECBD_1319
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ECBD_1319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ACT28382
UniProt: A0A140N5R8
LinkDB All DBs
Position
1393420..1395564
Genome map
AA seq 714 aa AA seqDB search
MEMTSAFTLNVRLDNIAVITIDVPGEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSA
KPDNFIAGADINMIGNCKTAQEAEALARQGQQLMAEIHALPIQVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAL
KLGLVDDVVPHSILLEAAVELAKKERPSSRPLPVRERILAGPLGRALLFKMVGKKTEHKT
QGNYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRSIFFASTDVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGIPVRIKDINPQGINHALKYSWDQLEGKV
RRRHLKASERDKQLALISGTTDYRGFAHRDLIIEAVFENLELKQQMVAEVEQNCAAHTIF
ASNTSSLPIGDIAAHATRPEQVIGLHFFSPVEKMPLVEIIPHAGTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTEGERVEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYPLIGAHGQGRLSAPQVAERCVMLMLNEAVRCVDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCERLVEMGARGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgacatcagcgtttacccttaatgttcgtctggacaacattgccgttatcacc
atcgacgtaccgggtgagaaaatgaataccctgaaggcggagtttgcctcgcaggtgcgc
gccattattaagcaactccgtgaaaacaaagagttgcgaggcgtggtgtttgtctccgct
aaaccggacaacttcattgctggcgcagacatcaacatgatcggcaactgcaaaacggcg
caagaagcggaagctctggcgcggcagggccaacagttgatggcagagattcatgctttg
cccattcaggttatcgcggctattcatggcgcttgcctgggtggtgggctggagttggcg
ctggcgtgccacggtcgcgtttgtactgacgatcctaaaacggtgctcggtttgcctgaa
gtacaacttggattgttacccggttcaggcggcacccagcgtttaccgcgtctgataggc
gtcagcacagcattagagatgatcctcaccggaaaacaacttcgggcgaaacaggcatta
aagctggggctggtggatgacgttgttccgcactccattctgctggaagccgctgttgag
ctggcaaagaaggagcgcccatcttcccgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgctgctgttcaaaatggtcggcaagaaaacagaacacaaaact
caaggcaattatccggcgacagaacgcatcctggaggttgttgaaacgggattagcgcag
ggcaccagcagcggttatgacgccgaagctcgggcgtttggcgaactggcgatgacgcca
caatcgcaggcgctgcgtagtatcttttttgccagtacggacgtgaagaaagatcccggc
agtgatgcgccgcctgcgccattaaacagcgtggggattttaggtggtggcttgatgggc
ggcggtattgcttatgtcactgcttgtaaagcggggattccggtcagaattaaagatatc
aacccgcagggcataaatcatgcgctgaagtacagttgggatcagctggagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactatcgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattgaaacaacagatggtggcggaagttgagcaaaattgcgccgctcataccatcttt
gcttcgaatacgtcatctttaccgattggtgatatcgccgctcacgccacgcgacctgag
caagttatcggcctgcatttcttcagtccggtggaaaaaatgccgctggtggagattatt
cctcatgcgggtacatcagcgcaaaccatcgccactacggtaaaactggcgaaaaaacag
ggcaaaacgcccattgtcgtgcgtgacaaagccgggttttacgtcaatcgcatcttagcg
ccttacattaatgaagctatccgcatgctgaccgaaggtgaacgggtagagcacattgat
gccgcgctagtgaaatttggttttccggtaggtccaatccaacttttggatgaggttgga
atcgacaccgggactaaaattattcctgtactggaagccgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggt
cggggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcccgcc
atttacccgctcattggcgcacatgggcaggggcgactctccgcaccgcaggttgctgaa
cggtgtgtgatgttgatgctgaatgaagcagtacgttgtgttgatgagcaggttatccgt
agcgtgcgtgacggggatattggcgcggtatttggcattggttttccgccatttctcggt
ggaccgttccgctatatcgattctctcggcgcgggcgaagtggttgcaataatgcaacga
cttgccacgcagtatggttcccgttttaccccttgcgagcgtttggtcgagatgggcgcg
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system