KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_1419Help
Entry
ECBD_1419         CDS       T00939                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase, anaerobic, A subunit
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00564  Glycerophospholipid metabolism
ebd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECBD_1419
Enzymes [BR:ebd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ECBD_1419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored DAO_C Pyr_redox_2 Thi4 3HCDH_N HI0933_like NAD_binding_8 SO_alpha_A3 Pyr_redox_3 Lycopene_cycl GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ACT28482
UniProt: A0A140N619
LinkDB All DBs
Position
complement(1495260..1496888)
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQSSDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTNGLFITLPEDDLSFQATFIRACEEAGISAEA
IDPQQARIIEPAVNPALIGAVKVPDGTVDPFRLTAANMLDAKEHGAVILTAHEVTGLIRE
GATVCGVRVRNHLTGETQALHAPVVVNAAGIWGQHIAEYADLRIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSLRIDYNEIDDNRVTAEEVDILLREGEKLAP
VMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLLDHAERDGLDGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCTTADLALPGSQEPAEVTLRKVISLPAPLRGSAVYRHGDRTP
AWLSEGRLHRSLVCECEAVTAGEVQYAVENLNVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTSAQSIEQLSTFLNERWKGVQPIAWGDALRESEFTRWVYQGLCGLEKEQKD
AL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgcgactcgcaatcaagtgacgtgattatcattggcggcggcgcaacggga
gccgggattgcccgcgactgtgccctgcgcgggctgcgcgtgattttggttgagcgccac
gacatcgcaaccggtgccaccgggcgtaaccacggcctgctgcacagcggtgcgcgctat
gcggtaaccgatgcggaatcggcccgcgaatgcattagtgaaaaccagatcctgaaacgc
attgcacgtcactgcgttgaaccaaccaacggcctgtttatcaccctgccggaagatgac
ctctccttccaggccacttttattcgcgcctgcgaagaagcagggatcagcgcagaagct
atagacccgcagcaagcgcgcattatcgaacctgccgttaacccggcactgattggcgcg
gtgaaagttccggatggcaccgttgatccatttcgtctgaccgcagcaaacatgctggat
gccaaagaacacggtgccgttatccttaccgctcatgaagtcacggggctgattcgtgaa
ggcgcgacggtgtgcggtgttcgtgtacgtaaccatctcaccggcgaaactcaggccctt
catgcacctgtcgtggttaatgccgctgggatctgggggcaacacattgccgaatatgcc
gatctgcgcattcgcatgttcccggcgaaaggatcgctgctgatcatggatcaccgcatt
aaccagcatgtgatcaaccgctgccgtaaaccttccgacgccgatattctggtgcctggc
gataccatttcgctgattggtaccacctctttacgtattgattacaacgagattgacgat
aatcgagtgacggcagaagaggttgatattctgctgcgtgaaggggaaaaactggccccc
gtgatggcgaaaacgcgcattttgcgggcctattctggcgtgcgcccgctggttgccagc
gatgacgacccgagcggacgtaacgtcagccgtggcatcgtgctgctcgaccatgctgaa
cgcgatggtctggacggatttatcaccatcaccggtggcaaactgatgacctatcggctg
atggctgaatgggctaccgacgcggtatgccgcaaactgggcaacacgcgcccctgtacg
actgccgatctggcactgcctggttcacaagaacccgctgaagttaccttgcgtaaagtc
atctccctgcctgccccgctgcgcggttctgcggtttatcgtcatggcgatcgcacgcct
gcctggctgagcgaaggccgtctgcaccgtagcctggtatgtgagtgcgaagcggtaact
gcgggtgaagtgcagtacgcggtagaaaatttaaacgttaatagcctgctggatttacgc
cgtcgtacccgtgtgggtatgggcacctgccagggcgaactctgcgcctgccgcgctgcc
ggactgctgcaacgttttaacgtcacgacgtccgcgcaatctatcgagcaactttccacc
ttccttaacgaacgctggaaaggcgtgcaacccatcgcctggggagatgcactgcgcgaa
agcgaatttacccgctgggtttatcagggattgtgtggtctggagaaggagcagaaagat
gcgctttga

DBGET integrated database retrieval system