KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_1619
Entry
ECBD_1619         CDS       T00939                                 

Definition
(GenBank) DegT/DnrJ/EryC1/StrS aminotransferase
  KO
K20429  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00541  O-Antigen nucleotide sugar biosynthesis
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    ECBD_1619
Enzymes [BR:ebd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     ECBD_1619
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP SelA Beta_elim_lyase SHMT
Other DBs
NCBI-ProteinID: ACT28678
UniProt: A0A140N7T7
LinkDB
Position
1732624..1733736
AA seq 370 aa
MNDKTIPVTQPSLPELAEFMPYLEKIWKNKWLTNNGPFHQELEEKLCEFLGVQHISLFNN
ATIALITALQALRITGEVITTPYSFVATSHAILWNGLTPVFVDIENDGYNIDYRKIEQAI
TPKTSAILPVHCYSTPCEVEEIQKIADNYGLKVIYDAAHAFGVNFKGQSLLNYGDLSILS
FHATKVFNTFEGGAIISPDAKTKLRIDRLKNFGIADELTVTAPGINGKMSEINAAFGLVQ
LKHIEGSISKRKIIDSLYRNLLKGTPGITIFPGNINANSNYSYFPILIDDGFHMSRDQAY
ELLKKNNILSRKYFYPLISNMPMYRGLISASVDNLPIANSVADKVLCLPIYTDLNEEIVV
KITKLLLGKM
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaacgataaaactattccagtaacgcaaccttctttgccggaacttgcagaattcatg
ccttacctggaaaaaatatggaaaaataaatggttgacaaataatggaccatttcatcaa
gaactcgaggaaaaattatgtgaatttttgggtgtgcagcatatctcgctttttaacaat
gcaacaattgcattgatcacagcattacaagccctaagaataacaggtgaggtaataaca
acaccatattcatttgttgcaacttcacatgctattttatggaatggacttacgcctgtc
tttgttgatattgaaaatgatggatataatattgattacagaaaaatagaacaggctatt
acaccaaaaacttcagcaattttacctgtccattgctactcaacaccctgtgaagtcgaa
gaaattcaaaaaatagctgataattatggattgaaagtaatctacgacgcagcacatgca
ttcggtgtaaattttaaagggcaaagtttacttaactatggtgatttatcaattcttagt
ttccatgcgacgaaagtcttcaatacatttgaaggtggggcaataattagccctgatgct
aaaaccaagttacgtatagatcgattaaaaaactttggtatcgccgacgagctgactgtg
acagctccaggaataaatggcaaaatgagtgaaattaatgctgcctttggacttgttcag
ttaaagcatattgagggctcaatatctaagcgaaaaataattgatagtctttaccggaat
ttactgaaagggactccgggtattactatatttccaggaaatataaatgcaaatagcaac
tattcatattttcctatactcatagatgatggttttcatatgagtcgtgatcaggcatat
gaattacttaagaaaaataatatcctatctcgaaagtatttttatccattaatcagtaat
atgcctatgtatcgaggattgatttcagctagcgttgataatctaccaatagccaatagt
gttgctgataaagtcctatgcttgccaatatatacagatttaaatgaagagattgttgtg
aaaataaccaaattattattgggtaagatgtga

DBGET integrated database retrieval system