KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_1870Help
Entry
ECBD_1870         CDS       T00939                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 ADH_N_2 Cupin_2 ThiF
Motif
Other DBs
NCBI-ProteinID: ACT28917
UniProt: A0A140N6H6
LinkDB All DBs
Structure
PDB: 

Position
1979269..1980312
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILQVPGTMKIISAEIPVPKEDEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVRKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGALVEPAAVGMHAAMLADVKPGKKIIILGAGCI
GLMTLQACKCLGATEIAVVDVLEKRLAMAEQLGATVVINGAKEDTIARCQQFTEDMGADI
VFETAGSAVTVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVTIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYRDVQQAFEESVNNKRDIIKGVIKISD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcaatattgcaggtgccgggcacaatgaaaattatttcagcagaa
ataccagtgcctaaagaagatgaagttttgattaaagtagaatatgtcggtatttgtggt
tcagatgtacatggttttgaatcaggcccgtttattccgcctaaagacccaaatcaagaa
attggcctgggtcatgaatgcgccgggacggttgtggctgtgggaagccgcgtgcgcaaa
tttaaaccgggggatcgggtaaatatcgaacctggcgttccttgcggtcactgtcgttac
tgtctggaaggcaaatataacatctgcccggacgttgattttatggcgacacaacccaac
taccgcggcgcattaacgcactatctgtgtcatccggagagctttacttacaaactgccc
gacaatatggacacgatggaaggggcgctggtggagcctgccgcagtcgggatgcatgcc
gcgatgctggcagatgttaaaccgggtaagaagataattattctgggagcaggttgtatt
ggtttgatgacgttgcaagcgtgcaaatgcctgggagcaacggaaattgccgtcgttgat
gtgctggaaaaacgtctggcaatggcggaacagcttggtgcgacagtggttattaacggc
gcaaaagaagacactattgcacgctgtcagcaatttaccgaagacatgggcgcagatatt
gttttcgaaacagcgggttctgcggtcaccgttaaacaggcaccttatctggtaatgcgc
ggcggtaaaattatgattgttggtactgtacccggcgattcggcaatcaatttcctcaaa
atcaatcgcgaagtcactatccagacggtattccgctatgccaatcgttatccggtcacg
attgaagctatttcttcagggcgattcgatgtgaaatcgatggtgacacatatttacgat
tatcgggatgtacaacaggcatttgaagagtcagttaacaacaaacgcgacattattaaa
ggcgttattaagattagcgattaa

DBGET integrated database retrieval system