KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_2110Help
Entry
ECBD_2110         CDS       T00939                                 

Definition
(GenBank) transcriptional regulator, MarR family
  KO
K03712  MarR family transcriptional regulator, multiple antibiotic resistance protein MarR
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ebd03000]
    ECBD_2110
Transcription factors [BR:ebd03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    ECBD_2110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 FeoC HTH_24 TrmB HNH_5 AbiEi_4
Motif
Other DBs
NCBI-ProteinID: ACT29149
UniProt: A0A140NBN9
LinkDB All DBs
Structure
PDB: 

Position
complement(2213533..2213967)
Genome map
AA seq 144 aa AA seqDB search
MKSTSDLFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVEL
KKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLH
QELTKNLTADEVATLEYLLKKVLP
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagtaccagcgatctgttcaatgaaattattccattgggtcgcttaatccatatg
gttaatcagaagaaagatcgtctgcttaacgagtatctgtctccgctggatattactgcg
gcacagtttaaggtgctctgctctatccgctgcgcggcgtgtattactccggttgaactg
aaaaaagtgttgtcggtcgacctgggagcactgacccgtatgctggatcgcctggtctgt
aaaggctgggtggaaaggttgccgaacccgaatgacaagcgcggcgtactggtaaaactt
accaccggcggcgcggcaatatgtgaacaatgccatcaattagttggccaggacctgcac
caagaattaacaaaaaacctgacggcggacgaagtggcaacacttgagtatttgcttaag
aaagtcctgccgtaa

DBGET integrated database retrieval system