KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_2184
Entry
ECBD_2184         CDS       T00939                                 

Definition
(GenBank) putative transferase
  KO
K11208  GST-like protein
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    ECBD_2184
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N GST_C_3 GST_C
Other DBs
NCBI-ProteinID: ACT29216
UniProt: A0A140N9V6
LinkDB
Position
complement(2301454..2302071)
AA seq 205 aa
MIKVYGVPGWGSTISELMLTLADIPYQFFDVSGFDHEGTSRELLKTLNPLCQIPTLALEN
DEIMTETAAIALMVLDRRPDLAPPVGRAERQLFQRLLVWLVANVYPTFTFADYPERWAPD
APEQLKKNVIEYRKSLYIWLNSQLTAEPYAFGEQLTLVDCYLCTMRTWGPGHEWFQDNAT
NISAIADAVCQLPKLQEVLKRNEII
NT seq 618 nt   +upstreamnt  +downstreamnt
atgattaaggtgtatggcgtacccggatggggctctacaatcagtgagctgatgctaaca
ctggctgatattccttatcagttctttgatgtcagtggttttgaccacgagggaacttca
cgcgagttattgaaaaccctgaacccgttgtgtcagattccgacactggcgctggaaaat
gacgagattatgacggagacagcggcgattgcattgatggttctcgatcgtcgcccggac
cttgcgccaccggttgggcgcgccgaacgtcagctgtttcaacggctattggtctggctg
gttgctaatgtctatccaacattcactttcgccgattaccctgagcgttgggctcctgac
gcacctgaacagttaaagaagaatgttattgaatatcgaaaatcgctttatatctggttg
aattcgcagctcactgctgaaccttatgcgtttggtgagcaactaacgctggtggactgt
tatctttgcactatgcgcacatgggggcctgggcatgaatggtttcaggataatgccacg
aatatcagtgcgattgctgatgctgtatgtcagttaccgaaattacaagaagtattaaaa
aggaatgaaattatttga

DBGET integrated database retrieval system