KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_2329Help
Entry
ECBD_2329         CDS       T00939                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00061  Fatty acid biosynthesis
ebd00780  Biotin metabolism
ebd01100  Metabolic pathways
ebd01130  Biosynthesis of antibiotics
ebd01212  Fatty acid metabolism
Module
ebd_M00083  Fatty acid biosynthesis, elongation
ebd_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ECBD_2329
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ECBD_2329
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ECBD_2329
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ebd01004]
    ECBD_2329
Enzymes [BR:ebd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ECBD_2329
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ECBD_2329
Lipid biosynthesis proteins [BR:ebd01004]
 Fatty acid synthase
  Component type
   ECBD_2329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ACT29356
UniProt: A0A140NA83
LinkDB All DBs
Structure
PDB: 

Position
2444976..2445764
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattctggtaaccggtgttgccagcaaactatccatc
gcctacggtatcgctcaggcgatgcaccgcgaaggagctgaactggcattcacctaccag
aacgacaaactgaaaggccgcgtagaagaatttgccgctcaattgggttctgacatcgtt
ctgcagtgcgatgttgcagaagatgccagcatcgacaccatgttcgctgaactggggaaa
gtttggccgaaatttgacggtttcgtacactctattggttttgcacctggcgatcagctg
gatggtgactatgttaacgccgttacccgtgaaggcttcaaaattgcccacgacatcagc
tcctacagcttcgttgcaatggcaaaagcttgccgctccatgctgaatccgggttctgcc
ctgctgaccctttcctaccttggcgctgagcgcgctatcccgaactacaacgttatgggt
ctggcaaaagcgtctctggaagcgaacgtgcgctatatggcgaacgcgatgggtccggaa
ggtgtgcgtgttaacgccatctctgctggtccgatccgtactctggcggcttccggtatc
aaagacttccgcaaaatgctggctcattgcgaagccgttaccccgattcgccgtaccgtt
actattgaagatgtgggtaactctgcggcattcctgtgctccgatctctctgccggtatc
tccggtgaagtagtccacgttgacggcggtttcagcatcgctgcaatgaacgaactcgaa
ctgaaataa

DBGET integrated database retrieval system