KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_2912Help
Entry
ECBD_2912         CDS       T00939                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00010  Glycolysis / Gluconeogenesis
ebd00260  Glycine, serine and threonine metabolism
ebd00680  Methane metabolism
ebd01100  Metabolic pathways
ebd01110  Biosynthesis of secondary metabolites
ebd01120  Microbial metabolism in diverse environments
ebd01130  Biosynthesis of antibiotics
ebd01200  Carbon metabolism
ebd01230  Biosynthesis of amino acids
Module
ebd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ebd_M00002  Glycolysis, core module involving three-carbon compounds
ebd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECBD_2912
  09102 Energy metabolism
   00680 Methane metabolism
    ECBD_2912
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECBD_2912
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ebd04131]
    ECBD_2912
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ebd04147]
    ECBD_2912
Enzymes [BR:ebd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ECBD_2912
Membrane trafficking [BR:ebd04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ECBD_2912
Exosome [BR:ebd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ECBD_2912
  Exosomal proteins of melanoma cells
   ECBD_2912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ACT29927
UniProt: A0A140N9D9
LinkDB All DBs
Structure
PDB: 

Position
3036382..3037134
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacttctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcattgcagggtctgaacaaa
gcggaaactgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaactattctgccgcgtatgaagagcggtgagcgcgtgatc
atcgctgcacacggtaactctttacgtgcgctggtgaaatatcttgataacatgagcgaa
gaagagattcttgagcttaatatcccgactggcgtgccgctggtgtatgagttcgacgag
aatttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcagcgaaagca
gcggcggttgcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system