KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_3470Help
Entry
ECBD_3470         CDS       T00939                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECBD_3470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ebd01003]
    ECBD_3470
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ebd01011]
    ECBD_3470
Enzymes [BR:ebd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     ECBD_3470
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ECBD_3470
Glycosyltransferases [BR:ebd01003]
 Polysaccharide
  Bacterial polysaccharide
   ECBD_3470
Peptidoglycan biosynthesis and degradation proteins [BR:ebd01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   ECBD_3470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H PBP1_TM Transpeptidase UvrB_inter DUF3484
Motif
Other DBs
NCBI-ProteinID: ACT30469
UniProt: A0A140NFF5
LinkDB All DBs
Structure
PDB: 

Position
complement(3613615..3616140)
Genome map
AA seq 841 aa AA seqDB search
MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEPMPRKGKGKGKGRKPR
GKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMTIS
KNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFDGDHL
ATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFPDLLVDTLLATEDRHFYEH
DGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALIMDAR
YSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIY
NPWRNPKLALERRNLVLRLLQQQQIIDGELYEMLSARPLGVQPRGGVISPQPAFMQLVRQ
ELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRF
SGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIAL
RQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPK
DQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAER
AVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTI
TWVGRDNNQPTKLYGASGAMSIYQRYLANQTPTPLNLVPPEDIADMGVDYDGNFVCSGGM
RVLPVWTSDPQSLCQQSEMQQQPSGNPFDQSSQPQQQQPAQQEQKDSDGVAGWIKDMFGS
N
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaatgaccgcgagccaattggacgcaaagggaaaccgacgcgtccggtcaaa
caaaaggtaagccgtcgtcgttacgaagatgacgatgattacgacgattatgatgactat
gaggatgaagaaccgatgccgcgcaaaggtaagggcaaaggcaaagggcgtaagcctcgt
ggcaaacgcggctggctatggctactgctaaaactggctatcgtttttgccgtgctgatc
gccatttacggcgtttatctcgatcaaaaaattcgtagccgtattgatggcaaggtctgg
caactgcctgcggcagtttatggccgaatggtcaatcttgagccagacatgaccatcagc
aagaacgagatggtgaagctgctggaggcgacccagtatcgtcaggtgtcgaaaatgacc
cgtcctggcgaatttaccgtgcaggctaacagcattgagatgatccgccgtccgtttgat
ttcccggacagcaaagaagggcaggtgcgtgcgcgtttgacctttgatggcgatcatctg
gcgaccatcgtcaatatggagaacaaccgtcagttcggcttcttccgtcttgatccgcgc
ctgatcaccatgatctcctcgccaaacggtgaacaacgtctgtttgtgccgcgcagtggt
ttccctgatttgctggtggatactttgctggcgacagaagaccgtcatttttacgagcat
gacggcatcagcctctactccatcggacgtgcggtgctggcaaacctgaccgcaggtcgc
acggtgcagggtgcgagtacgctgacgcaacagctggtgaaaaacctgttcctctccagc
gagcgctcttactggcgtaaagcgaacgaagcctatatggcgttgatcatggatgcgcgt
tacagcaaagatcgcattcttgagctgtatatgaatgaggtgtatctcggtcagagcggc
gacaacgaaattcgtggcttcccgctggcgagcctgtactactttggtcgcccggtagaa
gaattgagccttgaccagcaggcgctgttagttggcatggtgaaaggggcgtccatctac
aacccgtggcgtaacccgaaactggcgctggagcgacgtaatctggtgctgcgtttgcta
caacaacagcagattatcgatggtgaactgtatgaaatgctcagcgcgcgtcctctgggc
gtacagccgcgcggtggggtaatctctccacagccagcctttatgcaattggtgcgtcag
gagctgcaagcgaaattaggcgataaggtaaaagatctctccggcgtgaagatcttcact
acctttgactcggtggcccaggacgcggcagaaaaagccgccgtggaaggcattcctgca
ctgaagaaacagcgtaagttgagcgatcttgaaactgcgattgtggtcgtcgaccgcttt
agtggtgaagttcgtgcgatggtcggaggttctgagccgcagtttgcgggctacaaccgt
gcgatgcaggcgcgtcgttcgattggttcccttgcaaaaccagcgacttatctgacggcc
ttaagccagccgaaaatctatcgtctgaatacgtggattgcggatgcgccaattgcgctg
cgtcagccgaatggccaggtctggtcaccgcagaacgatgatcgtcgttatagcgaaagt
ggcagagtgatgctggtggatgcgttgacccgttcgatgaacgtgccgacggtaaatctg
gggatggcgctggggctgcctgcggttacggagacctggatcaaactgggcgtaccgaaa
gatcagttgcatccggttccggcgatgctgctgggggcgttgaacttaacgccaatcgaa
gtggcgcaggcattccagaccatcgccagcggtggtaaccgtgcaccgctttctgcactg
cgttcggtaatcgcggaagatggcaaagtgctgtatcagagcttcccgcaggcggaacgc
gctgttccggcgcaggcggcgtatctgacactatggaccatgcagcaggttgtacaacgc
ggtacgggtcgtcagcttggggcgaaatacccgaacctgcatctggcagggaaaacaggg
actaccaacaataacgtagatacctggtttgcgggcattgacggcagcacggtgaccatc
acctgggtaggccgtgataacaaccagccgaccaaactgtatggagccagcggggcaatg
tcgatttatcagcgttatctggctaaccagacgccaacaccgctgaatcttgttccgcca
gaagatattgcagatatgggcgtggactacgacggcaactttgtttgcagcggtggcatg
cgtgtcttgccggtctggaccagcgatccgcaatcgctgtgccagcagagtgagatgcag
cagcaaccgtcaggcaatccgtttgatcagtcttctcagccgcagcaacagcaacctgct
cagcaagagcagaaagacagcgacggtgtagccggttggattaaagatatgtttggtagt
aattaa

DBGET integrated database retrieval system