KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_3526Help
Entry
ECBD_3526         CDS       T00939                                 

Definition
(GenBank) UDP-N-acetylmuramate/alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00471  D-Glutamine and D-glutamate metabolism
ebd00550  Peptidoglycan biosynthesis
ebd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ECBD_3526
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECBD_3526
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ebd01011]
    ECBD_3526
Enzymes [BR:ebd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     ECBD_3526
Peptidoglycan biosynthesis and degradation proteins [BR:ebd01011]
 Precursor biosynthesis
  Amino acid ligase
   ECBD_3526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ACT30525
UniProt: A0A140NG76
LinkDB All DBs
Structure
PDB: 

Position
complement(3678677..3680152)
Genome map
AA seq 491 aa AA seqDB search
MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQISGSDLAPNPVTQQL
MNLGATIYFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIPVIRRAEMLAELMRFRH
GIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHARLGHGRYLIAEADESDA
SFLHLQPMVAIVTNIEADHMDTYQGDFENLKQTFINFLHNLPFYGRAVMCVDDPVIRELL
PRVGRQTTTYGFSEDADVRVEDYQQIGPQGHFTLLRQDKEPMRVTLNAPGRHNALNAAAA
VAVATEEGIDDEAILRALESFQGTGRRFDFLGEFPLEPVNGKSGTAMLVDDYGHHPTEVD
ATIKAARAGWPDKNLVMLFQPHRFTRTRDLYDDFANVLTQVDTLLMLEVYPAGEAPIPGA
DSRSLCRTIRGRGKIDPILVPDPAQVAEMLAPVLTGNDLILVQGAGNIGKIARSLAEIKL
KPQTPEEEQHD
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaatacacaacaattggcaaaactgcgttccatcgtgcccgaaatgcgtcgcgttcgg
cacatacattttgtcggcattggtggtgccggtatgggcggtattgccgaagttctggcc
aatgaaggttatcagatcagtggttccgatttagcgccaaatccggtcacgcagcagtta
atgaatctgggagcgacgatttatttcaaccatcgcccggaaaacgtacgtgatgccagc
gtggtcgttgtttccagcgcgatttctgccgataacccggaaattgtcgcagctcatgaa
gcgcgtattccggtgatccgtcgtgccgaaatgctggctgagttaatgcgttttcgtcat
ggcatcgccattgcaggaacgcacggcaaaacgacaaccaccgcgatggtttccagcatc
tacgcagaagcggggctcgacccaaccttcgttaacggcgggctggtaaaagcggcgggg
gttcatgcgcgtttggggcatggtcggtacctgattgccgaagcagatgagagtgatgca
tcgttcctgcatctgcaaccgatggtggcgattgtcaccaatatcgaagccgaccacatg
gatacctaccagggcgactttgagaatttaaaacagacttttattaattttctgcacaac
ctgcctttttacggtcgtgcggtgatgtgtgttgatgatccggtgatccgcgaattgtta
ccgcgagtgggacgtcagaccacgacttacggcttcagcgaagatgccgacgtgcgtgta
gaagattatcagcagattggcccgcaggggcactttacgctgctgcgccaggacaaagag
ccgatgcgcgtcaccctgaatgcgccaggtcgtcataacgcgctgaacgccgcagctgcg
gttgcggttgctacggaagagggaattgatgacgaggctattttacgtgcgctggagagc
ttccaggggactgggcgccgttttgatttcctcggtgaattcccgctggagccagtgaat
ggtaaaagcggtacggcgatgttggtcgatgactacggccaccacccgacggaagtggac
gccactattaaagcggcgcgtgcaggctggccggataaaaacctggtaatgctgtttcag
ccgcaccgttttacccgtacgcgcgacctgtatgatgatttcgccaatgtgctgacgcag
gttgataccctgttgatgctggaagtgtatccggctggcgaagcgccaattccgggagcg
gacagccgttcgctgtgtcgcacaattcgtggacgtgggaaaattgatcccattctggtg
ccggaccctgcgcaggtagccgagatgctggcaccggtattaaccggtaacgacctgatt
ctcgttcagggggctggtaatatcggaaaaattgcccgttctttagctgaaatcaaactg
aagccgcaaactccggaggaagaacaacatgactga

DBGET integrated database retrieval system