KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_3529Help
Entry
ECBD_3529         CDS       T00939                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine/D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00471  D-Glutamine and D-glutamate metabolism
ebd00550  Peptidoglycan biosynthesis
ebd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ECBD_3529
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECBD_3529
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ebd01011]
    ECBD_3529
Enzymes [BR:ebd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     ECBD_3529
Peptidoglycan biosynthesis and degradation proteins [BR:ebd01011]
 Precursor biosynthesis
  Amino acid ligase
   ECBD_3529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ACT30528
UniProt: A0A140ND30
LinkDB All DBs
Structure
PDB: 

Position
complement(3682514..3683830)
Genome map
AA seq 438 aa AA seqDB search
MADYQGKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGLDKLPEAVERHTGSLND
EWLMAADLIVASPGIALAHPSLSAAADAGIEIVGDIELFCREAQAPIVAITGSNGKSTVT
TLVGEMAKAAGVNVGVGGNIGLPALMLLDDECELYVLELSSFQLETTSSLQAVAATILNV
TEDHMDRYPFGLQQYRAAKLRIYENAKVCVVNADDALTMPIRGADERCVSFGVNMGDYHL
NHQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALADAAGLPRASSLKALTTFTGL
PHRFEVVLEHNGVRWINDSKATNVGSTEAALNGLHVDGTLHLLLGGDGKSADFSPLARYL
NGDNVRLYCFGRDGAQLAALRPEVAEQTETMEQAMRLLAPRVQPGDMVLLSPACASLDQF
KNFEQRGNEFARLAKELG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggctgattatcagggtaaaaatgtcgtcattatcggcctgggcctcaccgggctttcc
tgcgtggactttttcctcgctcgcggtgtgacgccgcgcgttatggatacgcgtatgaca
ccgcctggcctggataaattacccgaagccgtagaacgccacacgggcagtctgaatgat
gaatggctgatggcggcagatctgattgtcgccagtcccggtattgcactggcgcatcca
tccttaagcgctgccgctgatgccggaatcgaaatcgttggcgatatcgagctgttctgt
cgcgaagcacaagcaccgattgtggcgattaccggttctaacggcaaaagcacggtcacc
acgctagtgggtgaaatggcgaaagcggcgggggttaacgttggtgtgggtggcaatatt
ggcctgcctgcgttgatgctactggatgatgagtgtgaactgtacgtgctggaactgtcg
agcttccagctggaaaccacctccagcttacaggcggtagcagcgaccattctgaacgtg
actgaagatcatatggatcgctatccgtttggtttacaacagtatcgtgcagcaaaactg
cgcatttacgaaaacgcgaaagtttgcgtggttaatgctgatgatgccttaacaatgccg
attcgcggtgcggatgaacgctgcgtcagctttggcgtcaacatgggtgactatcacctg
aatcatcagcagggcgaaacctggctgcgggttaaaggcgagaaagtgctgaatgtgaaa
gagatgaaactttccgggcagcataactacaccaatgcgctggcggcgctggcgctggca
gatgctgcagggttaccgcgtgccagcagcctgaaagcgttaaccacattcactggtctg
ccgcatcgctttgaagttgtgctggagcataacggcgtacgttggattaacgattcgaaa
gcgaccaacgtcggcagtacggaagcggcgctgaatggcctgcacgtagacggcacactg
catttgttgctgggtggcgatggtaaatcggcggactttagcccactggcgcgttacctg
aatggcgataacgtacgtctgtattgtttcggtcgtgacggcgcgcagctggcggcgcta
cgcccggaagtggcagaacaaaccgaaactatggaacaggcgatgcgcttgctggctccg
cgtgttcagccgggcgatatggttctgctctccccagcctgtgccagccttgatcagttc
aagaactttgaacaacgaggcaatgagtttgcccgtctggcgaaggagttaggttga

DBGET integrated database retrieval system