KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_3801Help
Entry
ECBD_3801         CDS       T00939                                 

Definition
(GenBank) UDP-N-acetylmuramate
  KO
K02558  UDP-N-acetylmuramate: L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase [EC:6.3.2.45]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECBD_3801
Enzymes [BR:ebd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.45  UDP-N-acetylmuramate---L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptanedioate ligase
     ECBD_3801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ACT30788
UniProt: A0A140NDR7
LinkDB All DBs
Position
complement(3973700..3975073)
Genome map
AA seq 457 aa AA seqDB search
MRIHILGICGTFMGGLAMLARQLGHEVTGSDANVYPPMSTLLEKQGIELIQGYDASQLDP
QPDLVIIGNAMTRGNPCVEAVLEKNIPYMSGPQWLHDFVLRDRWVLAVAGTHGKTTTAGM
ATWILEQCGYKPGFVIGGVPGNFEVSARLGESDFFVIEADEYDCAFFDKRSKFVHYCPRT
LILNNLEFDHADIFDDLKAIQKQFHHLVRIVPGQGRIIWPENDINLKQTMAMGCWSEQEL
VGEQGHWQAKKLTTDASEWEVLLDGEKVGEVKWSLVGEHNMHNGLMAIAAARHVGVAPAD
AANALGSFINARRRLELRGEANGVTVYDDFAHHPTAILATLAALRGKVGGTARIIAVLEP
RSNTMKMGICKDDLAPSLGRADEVFLLQPAHIPWQVAEVAEACVQPAHWSGDVDTLADMV
VKTAQPGDHILVMSNGGFGGIHQKLLDGLAKKAEAAQ
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattcatattttaggaatttgtggcacatttatgggcggtctggcgatgctggcg
cgccagttaggccatgaagtaacgggttcggacgccaatgtgtatccgccgatgagcacc
ttacttgagaagcaaggcattgagctgattcagggttacgatgccagccagctcgatccg
cagccggatctggtgattattggcaacgccatgacccgtggaaatccgtgtgtggaagcg
gtactggaaaaaaacatcccttatatgtcaggtccacagtggctgcacgattttgtgctg
cgcgaccgctgggtgctggccgttgccggtacacacggcaaaactaccaccgcgggaatg
gcgacctggattctggaacagtgcggttacaaaccgggatttgtgatcggcggtgtgccg
gggaactttgaggtttcggcgcgtctgggcgaaagcgacttctttgttatcgaagcggat
gagtatgactgcgccttcttcgacaaacgctctaaatttgtccattactgcccgcgtacg
ctgatcctcaacaaccttgagttcgatcacgccgatatctttgacgacctgaaagcgatc
cagaaacagttccaccatctggtgcgtatcgttccggggcagggccgtattatctggccg
gaaaatgacatcaacctgaaacagaccatggcgatgggctgctggagcgagcaggagctg
gtgggtgagcagggtcactggcaggcgaaaaagctgaccaccgatgcttccgaatgggaa
gttttgctggatggcgaaaaagtgggcgaagtgaaatggtcgctggtaggcgaacataat
atgcacaatggcctgatggcgattgcagcggctcgccatgttggtgtagcgccggcagat
gccgctaacgcgctgggttcgtttattaatgctcgtcgccgtctggagttgcgtggtgaa
gcgaatggtgtgacggtatatgacgattttgcccatcacccgacggcgattctggcaacg
cttgcggcgctgcgtggcaaagttggtggtacggcgcgcattattgctgtgctggaaccg
cgctcgaataccatgaaaatggggatctgcaaagacgatctggcaccttcattaggtcgt
gccgatgaagtcttcctgctgcaaccggcgcatattccgtggcaggtggcagaagtggca
gaagcctgcgttcagcctgcacactggagtggcgatgtggatacgctggcagatatggtg
gtgaaaaccgctcagcctggcgaccatattctggtgatgagcaacggcggttttggtggg
atccatcagaaactgctggatggtctggcgaagaaggcggaagctgcgcagtaa

DBGET integrated database retrieval system