KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_4068Help
Entry
ECBD_4068         CDS       T00939                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00620  Pyruvate metabolism
ebd00680  Methane metabolism
ebd01100  Metabolic pathways
ebd01120  Microbial metabolism in diverse environments
ebd01200  Carbon metabolism
Module
ebd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECBD_4068
  09102 Energy metabolism
   00680 Methane metabolism
    ECBD_4068
Enzymes [BR:ebd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ECBD_4068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACT31051
UniProt: A0A140SS67
LinkDB All DBs
Structure
PDB: 

Position
4280827..4283478
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGEHILERVETIRKLSKSSRAGNDANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKNQPELSED
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDNKDIADYEHNQLMRRLRQ
LIAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVEF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVEATPELL
ALVGEEGAAEPYRYLMKNLRSRLMATQAWLEARLKGEELPKPEGLLTQNEELWEPLYACY
QSLQACGMGIIANGDLLDTLRRVKCFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWQPSAETREVLDTCQVIAEAPQGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNANDVMTQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEITVSSLSLYTGAILEANLLPPPEPKESWRRIMDEL
SVISCDLYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFAKADLWLAE
YYDQRLVDKALWPLGKELRNLQEEDIKVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEKEGQEPDPRVEQALMVTIAGIAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcattgcgtagtaatgtcagtatgctcggcaaagtgctggga
gaaaccatcaaggatgcgttgggagaacacattcttgaacgcgtagaaactatccgtaag
ttgtcgaaatcttcacgcgctggcaatgatgctaaccgccaggagttgctcaccacctta
caaaatttgtcgaacgacgagctgctgcccgttgcgcgtgcgtttagtcagttcctgaac
ctggccaacaccgccgagcaataccacagcatttcgccgaaaggcgaagctgccagcaac
ccggaagtgatcgcccgcaccctgcgtaaactgaaaaaccagccggaactgagcgaagac
accatcaaaaaagcagtggaatcgctgtcgctggaactggtcctcacggctcacccaacc
gaaattacccgtcgtacactgatccacaaaatggtggaagtgaacgcctgtttaaaacag
ctcgataacaaagatatcgctgactacgaacacaaccagctgatgcgtcgcctgcgccag
ttgatcgcccagtcatggcataccgatgaaatccgtaagctgcgtccaagcccggtagat
gaagccaaatggggctttgccgtagtggaaaacagcctgtggcaaggcgtaccaaattac
ctgcgcgaactgaacgaacaactggaagagaacctcggctacaaactgcccgtcgaattt
gttccggtccgttttacttcgtggatgggcggcgaccgcgacggcaacccgaacgtcact
gccgatatcacccgccacgtcctgctactcagccgctggaaagccaccgatttgttcctg
aaagatattcaggtgctggtttctgaactgtcgatggttgaagcgacccctgaactgctg
gcgctggttggcgaagaaggtgccgcagaaccgtatcgctatctgatgaaaaacctgcgt
tctcgcctgatggcgacacaggcatggctggaagcgcgcctgaaaggcgaagaactgcca
aaaccagaaggcctgctgacacaaaacgaagaactgtgggaaccgctctacgcttgctac
cagtcacttcaggcgtgtggcatgggtattatcgccaacggcgatctgctcgacaccctg
cgccgcgtgaaatgtttcggcgtaccgctggtccgtattgatatccgtcaggagagcacg
cgtcataccgaagcgctgggcgagctgacccgctacctcggtatcggcgactacgaaagc
tggtcagaggccgacaaacaggcgttcctgatccgcgaactgaactccaaacgtccgctt
ctgccgcgcaactggcaaccaagcgccgaaacgcgcgaagtgctcgatacctgccaggtg
attgccgaagcaccgcaaggctccattgccgcctacgtgatctcgatggcgaaaacgccg
tccgacgtactggctgtccacctgctgctgaaagaagcgggtatcgggtttgcgatgccg
gttgctccgctgtttgaaaccctcgatgatctgaacaacgccaacgatgtcatgacccag
ctgctcaatattgactggtatcgtggcctgattcagggcaaacagatggtgatgattggc
tattccgactcagcaaaagatgcgggagtgatggcagcttcctgggcgcaatatcaggca
caggatgcattaatcaaaacctgcgaaaaagcgggtattgagctgacgttgttccacggt
cgcggcggttccattggtcgcggcggcgcacctgctcatgcggcgctgctgtcacaaccg
ccaggaagcctgaaaggtggcctgcgcgtgactgaacagggcgagatgatccgctttaaa
tatggtctgccagaaatcaccgtcagcagcctgtcgctgtacaccggggcgattctggaa
gccaacctgctgccaccacctgagccgaaagagagctggcgtcgcattatggatgaactg
tcagtcatctcctgcgatctctaccgtggctacgtacgtgaaaacaaagattttgtgcct
tacttccgctccgctacgccggaacaagaattgggcaaactgccgttgggttcacgtccg
gcgaaacgtcgcccaaccggcggcgtcgagtcactacgcgccattccgtggatcttcgcc
tggacgcaaaaccgtctgatgctccccgcctggctgggtgcaggtacggcgctgcaaaaa
gttgtcgaagacggcaaacagagcgagctggaggctatgtgccgcgattggccattcttc
tcgacgcgtctcggcatgctggagatggtcttcgccaaagcagacctgtggctggcggaa
tactatgaccaacgcctggtagacaaagcactgtggccgttaggtaaagagttacgcaac
ctgcaagaagaagacatcaaagtggtgctggcgattgccaacgattcccatctgatggcc
gatctgccgtggattgcagagtctattcagctacggaatatttacaccgacccgctgaac
gtattgcaggccgagttgctgcaccgctcccgccaggcagaaaaagaaggccaggaaccg
gatcctcgcgtcgaacaagcgttaatggtcactattgccgggattgcggcaggtatgcgt
aataccggctaa

DBGET integrated database retrieval system