KEGG   Escherichia coli BL21(DE3): B21_01290Help
Entry
B21_01290         CDS       T02096                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
ebe00250  Alanine, aspartate and glutamate metabolism
ebe00410  beta-Alanine metabolism
ebe00640  Propanoate metabolism
ebe00650  Butanoate metabolism
ebe01100  Metabolic pathways
ebe01120  Microbial metabolism in diverse environments
Module
ebe_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ebe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    B21_01290 (puuE)
   00650 Butanoate metabolism
    B21_01290 (puuE)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B21_01290 (puuE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B21_01290 (puuE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ebe01007]
    B21_01290 (puuE)
Enzymes [BR:ebe01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B21_01290 (puuE)
Amino acid related enzymes [BR:ebe01007]
 Aminotransferase (transaminase)
  Class III
   B21_01290 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CAQ31807
UniProt: A0A140N8G5
LinkDB All DBs
Position
1351910..1353175
Genome map
AA seq 421 aa AA seqDB search
MSNNEFHQRRLSATPRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPD
LVAAVEQQLQQFTHTAYQIVPYESYVTLAEKINALAPVSGQAKTAFFTTGAEAVENAVKI
ARAHTGRPGVIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYHVPYPSDLHGISTQ
DSLDAIERLFKSDIEAKQVAAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEV
QSGFARTGKLFAMDHYADKPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGN
PLAVAAAHAVLNIIDKESLCERANQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAVEFND
PQTGEPSAAIAQKIQQRALAQGLLLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALS
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaatgaattccatcagcgtcgtctttctgccaccccgcgcggggttggcgtg
atgtgtaacttcttcgcccagtcggctgaaaacgctacgctgaaggatgttgagggcaac
gagtacatcgatttcgccgcaggcattgcggtgctgaataccgggcatcgccaccctgat
ctggtcgcggcggtggagcagcaactgcaacagtttacccacaccgcgtatcagattgtg
ccgtatgaaagctacgtcaccctggcggagaaaatcaacgcccttgccccggtgagcggg
caggccaaaaccgcgttcttcaccaccggtgcggaagcggtggaaaacgcggtgaaaatt
gctcgcgcccataccggacgccctggcgtgattgcgtttagcggcggctttcacggtcgt
acgtatatgaccatggcgctgaccggaaaagttgcgccgtacaaaatcggcttcggcccg
ttccctggttcggtgtatcacgtaccttatccgtcagatttacacggcatttcaacacag
gactccctcgacgccatcgaacgcttgtttaaatcagacatcgaagcgaagcaggtggcg
gcgattattttcgaaccggtgcagggcgagggcggtttcaacgttgcgccaaaagagctg
gttgccgctattcgccgcctgtgcgacgagcacggtattgtgatgattgctgatgaagtg
caaagcggctttgcgcgtaccggtaagctgtttgccatggatcattacgccgataagccg
gatttaatgacgatggcgaaaagcctcgcgggcgggatgccgctttcgggcgtggtcggt
aacgcgaatattatggacgcacccgcgccgggcgggcttggcggcacctacgccggtaac
ccgctggcggtggctgccgcgcacgcggtgctcaatattatcgacaaagaatcactctgc
gaacgcgcgaatcaactgggccagcgtctcaaaaacacgttgattgatgccaaagaaagc
gttccggccattgctgcggtacgcggcctggggtcgatgattgcggtagagtttaacgat
ccgcaaacgggcgagccgtcagcggcgattgcacagaaaatccagcaacgcgcgctggcg
caggggctgctcctgctgacctgtggcgcatacggcaacgtgattcgcttcctgtatccg
ctgaccatcccggatgcgcaattcgatgcggcaatgaaaattttgcaggatgcgctgagc
gattaa

DBGET integrated database retrieval system