KEGG   Enterobacteriaceae bacterium FGI 57: D782_0374Help
Entry
D782_0374         CDS       T02431                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ebf03012]
    D782_0374
   03029 Mitochondrial biogenesis [BR:ebf03029]
    D782_0374
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ebf04147]
    D782_0374
Translation factors [BR:ebf03012]
 Eukaryotic Type
  Elongation factors
   D782_0374
 Prokaryotic Type
   D782_0374
Mitochondrial biogenesis [BR:ebf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    D782_0374
Exosome [BR:ebf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   D782_0374
  Exosomal proteins of breast cancer cells
   D782_0374
  Exosomal proteins of colorectal cancer cells
   D782_0374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AGB76444
UniProt: L0LXU8
LinkDB All DBs
Position
403454..404638
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GEAEWEAKIIELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVMS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgtcaacgttggtactatcggccac
gtcgaccacggtaaaactactctgaccgctgcaatcaccaccgtactggctaaaacctac
ggcggtgcagctcgtgctttcgaccagatcgataacgcaccggaagaaaaagctcgtggt
atcaccatcaacacttcccacgttgaatatgacaccccgactcgccactacgcgcacgta
gactgcccgggccacgccgactatgttaaaaacatgatcaccggtgctgcgcagatggac
ggcgcgatcctggttgttgctgcgactgacggcccgatgccgcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggtagaaatggaagttcgtgaacttctgtctcag
tacgacttcccgggcgacgacactccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgaagcagagtgggaagcgaaaatcatcgaactggctggcttcctggattcttacatc
ccggaaccagaacgtgctatcgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagaacgcggtatcatcaaagttggt
gaagaagttgaaatcgttggtatcaaagagactgctaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggttccatcaag
ccgcacaccaaattcgaatctgaagtttatatcctgtccaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccgcagttctacttccgtactactgacgtgactggt
accatcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtaccgttggcgcgggcgttgttgctaaagtaatgagctaa

DBGET integrated database retrieval system