KEGG   Enterobacteriaceae bacterium FGI 57: D782_1702Help
Entry
D782_1702         CDS       T02431                                 

Definition
(GenBank) glycosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00500  Starch and sucrose metabolism
ebf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    D782_1702
Enzymes [BR:ebf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     D782_1702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: AGB77701
UniProt: L0M4Q5
LinkDB All DBs
Position
complement(1776371..1777858)
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPTGGELWPEVEALAPNLNEIGINMIWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSVATKYGDKGQLLAAIDALKKHDIAVLLDVVVNHKMGADEKERIRVQRV
NQDDRTQIDEEIVECEAWTRYTFPVRAGQYSKFIWDYKCFSGIDHIEDPNEDGIFKIVND
YTGEGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMDQTHCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQQYIDQVDGQTMLFDAPLQMHFHEAS
RMGADYDMSQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLFGAHYEDTGGDGETYTIDMPVIEQLHELIDARQRFAHGVQTLWFDHPNCI
AFSRSGTDDAPGCVVVLSNGDDGEKTITLGENYGNKRWKDFLNNREEIVETDEAGSATFT
CKGGSVSVWVLEDVL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaccccaccctcttgcagtgctttcattggtattaccccacgggcggcgagtta
tggcccgaagttgaggcgcttgcgccgaatctgaatgaaatcggtatcaatatgatctgg
ctgccgcccgcctataaaggcgcgtcaggcggctattctgtgggctatgacagctacgat
ctgttcgatttaggcgagtttgatcaaaaaggcagcgttgccactaaatatggtgacaag
ggccagctactggcagctatcgatgcccttaaaaagcacgatatcgccgtactgctggac
gtggtggtaaaccacaaaatgggggcggatgagaaagagcgcattcgcgtgcagcgggtt
aatcaggacgatcgcacgcagatcgatgaagagattgtggagtgtgaagcctggacacgc
tacaccttccctgttcgcgcagggcaatattcaaaatttatctgggattacaaatgcttc
agcgggatcgatcatattgaggacccgaatgaagacggtattttcaaaatcgtcaacgac
tataccggcgaaggctggaacgatcaggttgatgatgagatgggtaactttgactacctg
atgggcgaaaatatcgattttcgtaatcacgcagtcaccgaagagatcaaatactgggcg
cgctgggtgatggatcaaacccactgcgacggtttccgtctcgacgcggtaaaacatatt
ccggcctggttctataaagagtggattgagcacgtccaggaagtggcgcccaaaccgctc
tttattgtggccgagtactggtcgcatgaagtggacaaactgcaacagtatatcgatcag
gtcgacggccagacgatgctgttcgatgcgccattgcagatgcattttcatgaagcctca
cgcatgggcgcggattacgacatgagccagatttttaccggcacgctggtggaagccgat
ccgttccacgcggtaacgctggtcgccaaccacgatacccaaccgcttcaggcactggag
gccccggttgaagcctggtttaaaccgctggcgtatgcgctgatcctgctgcgggaaaac
ggcgtgccttcggtcttttatcccgatcttttcggcgcgcactacgaagataccggcggc
gatggcgaaacctacaccatcgatatgccggtcattgaacaactgcatgagctaatcgac
gcgcgccagcgtttcgcccacggcgtacaaaccctgtggttcgatcatcccaactgcatc
gccttcagccgcagcggcaccgacgacgcgccggggtgcgtggtggtcctgtctaacggc
gacgatggcgaaaaaaccattacgcttggcgaaaattacggcaacaaacgctggaaggat
ttcctcaataaccgggaagaaattgttgagaccgatgaggcgggcagcgcaaccttcacc
tgtaagggtggaagcgtgagcgtatgggtactggaggatgtgctgtaa

DBGET integrated database retrieval system