KEGG   Enterobacteriaceae bacterium FGI 57: D782_2112
Entry
D782_2112         CDS       T02431                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11208  GST-like protein
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    D782_2112
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_3
Other DBs
NCBI-ProteinID: AGB78095
UniProt: L0M5S5
LinkDB
Position
2197413..2198030
AA seq 205 aa
MITLYGALGWGSAISELMLTLAQIPYTFIDVDGFDQPGPKRELLKARNPLCQVPTLELEN
GEIMTETAAIALMVLDRCPDLAPPVGRAERQQFQRLLIWLVANVYPTFTYADYPERWAEK
APEQLKENCIEYRKSLYRWLETQLSAQPYAVGSEITLLDCYIAVMVSWGPRRPWFEANTP
GLVSVADEVYRREELQQVLRDNKLI
NT seq 618 nt   +upstreamnt  +downstreamnt
atgataacgctctacggtgcacttggctggggttccgccatcagcgaactgatgttaacg
ctcgcgcaaataccttatacgtttattgatgttgatggttttgaccagccggggccaaag
cgcgaattactgaaagcgcgcaatccgctttgccaggtgccgacgctggaactggaaaat
ggcgaaatcatgaccgagacggcggccatcgccctgatggtgctcgaccgttgccccgat
cttgcgccgccggtggggcgagcggaaaggcaacagtttcaacgtctgcttatctggctg
gttgccaatgtgtatcccactttcacctatgctgattatcccgaacggtgggctgaaaaa
gccccggagcagttaaaagaaaactgcattgaatatcgcaagtctctttatcgctggctg
gaaacacagcttagcgctcagccctacgcggtgggcagtgagataacattacttgattgc
tatatcgcggtgatggtgagctgggggccacgacgaccctggtttgaggccaatacgcca
gggttagtttcagtggcagatgaggtctaccggcgtgaagaactccagcaggtgctgcgt
gataataaattaatctga

DBGET integrated database retrieval system