KEGG   Enterobacteriaceae bacterium FGI 57: D782_2802Help
Entry
D782_2802         CDS       T02431                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00250  Alanine, aspartate and glutamate metabolism
ebf00280  Valine, leucine and isoleucine degradation
ebf00410  beta-Alanine metabolism
ebf00640  Propanoate metabolism
ebf00650  Butanoate metabolism
ebf01100  Metabolic pathways
ebf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    D782_2802
   00650 Butanoate metabolism
    D782_2802
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D782_2802
   00280 Valine, leucine and isoleucine degradation
    D782_2802
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D782_2802
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ebf01007]
    D782_2802
Enzymes [BR:ebf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     D782_2802
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     D782_2802
Amino acid related enzymes [BR:ebf01007]
 Aminotransferase (transaminase)
  Class III
   D782_2802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGB78757
UniProt: L0M628
LinkDB All DBs
Position
2864920..2866200
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAVPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFELENLLQKANDLGQKLKDGLLAIAEKHQEIGDVRGLGAMIAIELF
EDGDHSKPNAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIIGQC
FDEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcagttcctcgtggcgttggg
caaattcaccccattttcgctgatcgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaggtagttgccgcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatctggagctgtgcgaaataatgaatcagaaggtaccaggcgat
ttcgccaaaaaaacgctgctggtcaccacaggttccgaagcggtggaaaacgcggtgaaa
atcgcccgcgccgccaccaaacgtagcggcaccatcgcgtttagcggcgcgtatcacggg
cgcacgcattacactttggcgctgaccggcaaggtgaatccgtactctgcgggcatgggc
ctgatgccgggccatgtttatcgcgcgctttatccttgcccgctgcacggcatcagcgag
gatgacgctatcgccagtatccaccgaatcttcaaaaatgacgccgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctatgccgcgactccagcc
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgaaccggcacgctgtttgcgatggagcaaatgggcgtggca
cccgatctcaccacctttgcgaaatcgatcgcaggcggtttcccgctggcgggcgtcacc
gggcgcgcggaagtgatggatgccgtcgcaccgggcggtctgggcggcacctatgccggt
aacccgattgcctgcgtggctgcgctggaagtgttgaaggtgtttgagctggaaaatctg
ctgcaaaaagccaacgatctgggacagaagctgaaagacggattgctggcgatagccgaa
aaacaccaggagatcggcgacgtacgtgggctgggagcgatgatcgccatagagctgttt
gaagatggcgatcacagtaaaccgaacgccaaactcaccgccgagatcgtggcgcgcgcc
cgcgataagggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagattatcggtcagtgt
tttgatgaggcgaagcagtag

DBGET integrated database retrieval system