KEGG   Enterobacteriaceae bacterium FGI 57: D782_2866
Entry
D782_2866         CDS       T02431                                 

Definition
(GenBank) putative N6-adenine-specific DNA methylase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ebf03009]
    D782_2866
Enzymes [BR:ebf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     D782_2866
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     D782_2866
Ribosome biogenesis [BR:ebf03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    D782_2866
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_31 Methyltransf_25 MTS Methyltransf_11 Methyltransf_15 Methyltransf_24 N6_Mtase
Other DBs
NCBI-ProteinID: AGB78819
UniProt: L0M4J4
LinkDB
Position
complement(2925203..2927308)
AA seq 701 aa
MNSLFASTARGLEELLKTELEGLGAQECKVTQGGVHFQGDTRLLYQSLMWSRLASRIMMP
LGECSVWSDLDLYLGVQAINWTEIFTPNATFAVSFNGLNDEIRNSQYGALKVKDAIVDAF
TRKNLPRPNVDRENPDLRINVRLNKEKAFISLDLSGEGLHLRGYRDRTGLAPIKENLAAA
IVMRSGWVPGTPLLDPMCGSGTLLIEAAMWATDRAPGLHRGHWGFGGWAQHDDAIWQEVK
ADAQTRARAGLAAYESRFYGSDTDRRVVEIARSNARRAGIGELITFEQKDVAQLTNPLPK
GPYGTVISNPPYGERLESEPALIALHSLLGRIMKSQFGGWNLSLFSASPELLSCVSLRAE
RQFKAKNGPLDCIQKNYHVAESTGELKATVAEDYANRLRKNLKKLEKWAKQEGIECYRLY
DADLPEYNVAVDRYADWVVVQEYAPPKTVDAHKARQRLFDIIAATISVLGIAPNKLVLKT
RERQKGKNQYEKMNEKGEFMEVSEYNARLWVNLTDYLDTGLFLDHRIARRMLGQMSKGKD
FLNLFSYTGSASVHAGLGGARSTTTVDMSRTYLEWAERNLRLNGLTGRAHRLMQADVLAW
LRDTDEQFDVIFIDPPTFSNSKRMEDAFDVQRDHLRLMKDLKRLLRKGGTIMFSNNKRGF
RMDHDGLAELGLKAQDITHKTQSQDFARNRQIHNCWLITAA
NT seq 2106 nt   +upstreamnt  +downstreamnt
atgaattctctgtttgccagtacggcccgtgggctggaagagctgttaaaaactgaactg
gaaggtctgggcgcgcaagagtgcaaagtaacccagggtggggtccattttcagggagac
acgcgccttctttatcaaagcctgatgtggagtcgcctggcgtcgcgcatcatgatgccg
ctgggcgagtgcagtgtctggagcgatctggacctctatctcggcgtgcaggcgatcaac
tggacggagatcttcaccccgaacgccacttttgccgtgagctttaacgggctgaacgat
gagatccgtaacagccagtacggtgcgctgaaagtaaaagacgccatcgtcgatgcgttt
acgcgcaagaatttgccgcgcccgaatgtcgatcgcgaaaatcctgacctgcgcatcaac
gtgcggttgaacaaagagaaggcgtttatctctctcgatctgagcggtgagggcctgcat
ctgcgcggctaccgcgatcgcaccggtctggcgccgatcaaagagaacctcgcggcggcg
attgtcatgcgttctggctgggtgccggggacaccgctgctcgatccgatgtgtggttcc
ggtacgctgctgattgaagcggcaatgtgggcgaccgatcgcgcgccggggctgcatcgt
ggccactggggctttggcggctgggcgcagcacgacgacgcaatctggcaggaagtgaaa
gccgatgcgcaaacccgcgcacgcgcaggtcttgcggcgtatgaatcgcgtttttacggc
tctgataccgaccgtcgcgtcgtggagattgcgcgcagcaacgcccgtcgcgccggtatt
ggcgagctgattaccttcgaacaaaaagacgtggcgcagctgaccaacccgctgccaaaa
ggcccgtacgggaccgttatcagcaacccgccatacggcgagcgtctggagagcgaaccg
gcgctgattgccctgcacagcctgctgggccgcatcatgaaaagccagtttggcggctgg
aacctgtcgctgtttagcgcctcgccggaactgctgagctgcgtgtcgctgcgtgctgag
cgccagtttaaagccaaaaacggcccgctggattgtattcagaagaactatcatgttgcg
gaaagcaccggcgaactgaaagccaccgttgcggaagattacgccaaccgcctgcgtaaa
aatctcaagaaacttgagaagtgggcgaagcaggaaggtattgagtgctatcgcctgtac
gatgctgacctgccggagtataacgtggccgtcgaccgctacgccgactgggtcgtcgtg
caggagtatgcgccgccgaaaaccgtggatgcgcacaaagcacgccagcgcctgtttgat
attatcgccgccactatctcggtgctgggcatcgcgccgaataaactggtgctgaaaacc
cgtgagcgccagaaaggcaaaaatcagtacgagaaaatgaacgagaagggcgaattcatg
gaggtgagcgaatataacgcccgcctgtgggttaacctgacggattatctcgatactggc
ctgttcctcgaccaccgcatcgcccgtcgcatgctgggtcagatgagtaaaggcaaagat
ttccttaacctcttctcctacaccggtagcgccagcgttcacgcgggcctgggcggcgcg
cgttccacgaccacggtcgatatgtcgcgcacctacctcgagtgggccgagcgcaacctg
cgtctgaatggcctgaccggtcgcgctcatcgcctgatgcaggcggatgtgctcgcctgg
ctgcgcgataccgacgaacagttcgacgtgatcttcatcgatccgccgaccttctccaac
tcaaaacgtatggaagatgcgtttgatgttcagcgcgatcacctgcgcctgatgaaagac
ctgaagcgtctgctgcgtaaaggcggcaccatcatgttctcgaacaacaaacgcggtttc
cgtatggatcacgacggcctggccgaactgggactgaaagcacaagacattacccataaa
acacagtctcaggatttcgcccgtaaccgtcagatccacaactgctggctgattaccgca
gcctga

DBGET integrated database retrieval system