KEGG   Enterobacteriaceae bacterium FGI 57: D782_3132Help
Entry
D782_3132         CDS       T02431                                 

Definition
(GenBank) succinate dehydrogenase subunit B
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00020  Citrate cycle (TCA cycle)
ebf00190  Oxidative phosphorylation
ebf00650  Butanoate metabolism
ebf01100  Metabolic pathways
ebf01110  Biosynthesis of secondary metabolites
ebf01120  Microbial metabolism in diverse environments
ebf01130  Biosynthesis of antibiotics
ebf01200  Carbon metabolism
Module
ebf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ebf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D782_3132
   00650 Butanoate metabolism
    D782_3132
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    D782_3132
Enzymes [BR:ebf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     D782_3132
    1.3.5.4  fumarate reductase (quinol)
     D782_3132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4
Motif
Other DBs
NCBI-ProteinID: AGB79076
UniProt: L0M8N9
LinkDB All DBs
Position
complement(3217131..3217847)
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDDAPRMQEYTLEGEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALGNGKQKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQGPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgaattttcaatttatcgctataacccggatgtcgatgacgctccgcgcatg
caggaatacaccctggaaggcgaagaagggcgcgacatgatgctgctggatgcgctcatc
cagttgaaagagaaagacccaagtctgtcgttccgccgctcctgccgtgaaggggtttgt
ggttccgatggcctgaatatgaacggcaaaaacggtctggcctgcatcacgccaatttcg
gcgctgggcaatggcaaacagaagattgttatccgtccgctgccaggtttaccggtcatt
cgtgatttggtggtagacatggggcaattctatgcacaatatgagaagattaagccttac
ttgttgaataatgggcaaaatcctcctgctcgcgagcacctccaggggccagagcagcgt
gaaaaactcgatgggttgtacgagtgtatcctgtgtgcatgttgctcgacgtcctgccca
tcgttctggtggaacccggataagtttatcggcccggctggtctgttggcagcgtaccgc
ttcctgattgacagccgtgataccgaaaccgacagccgacttgatggcctgagtgacgct
ttcagcgtattccgctgccatagcatcatgaactgcgtcagtgtatgtccaaaggggctg
aacccgacgcgcgcgattggtcatattaagtcaatgttgttgcagcgcagtgcgtaa

DBGET integrated database retrieval system