KEGG   Enterobacteriaceae bacterium FGI 57: D782_3133Help
Entry
D782_3133         CDS       T02431                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00020  Citrate cycle (TCA cycle)
ebf00190  Oxidative phosphorylation
ebf00650  Butanoate metabolism
ebf01100  Metabolic pathways
ebf01110  Biosynthesis of secondary metabolites
ebf01120  Microbial metabolism in diverse environments
ebf01130  Biosynthesis of antibiotics
ebf01200  Carbon metabolism
Module
ebf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ebf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D782_3133
   00650 Butanoate metabolism
    D782_3133
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    D782_3133
Enzymes [BR:ebf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     D782_3133
    1.3.5.4  fumarate reductase (quinol)
     D782_3133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: AGB79077
UniProt: L0M6Z9
LinkDB All DBs
Position
complement(3217863..3219629)
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNADGAVVGC
TALCIETGEVVYFKANATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEQGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGALRDATEEEIDASLQRLNRWNGNRDGEDPVEIRKALQECMQHNFSVFREGDAM
AKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDYPDRDDANWLCHSLYLPESESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccagtaagagaatttgatgctgttgtgattggtgccggtggcgcgggtatg
cgtgcggcactgcaaatttcccagagcggccagacctgtgcgctgctctctaaagttttc
ccaacccgttcgcacaccgtatccgcacagggtggtatcaccgttgcgctgggtaacacc
catgaagataactgggaatggcacatgtacgacaccgtaaaaggatcggactacattggt
gaccaggatgcgatcgaatatatgtgtaaaaccggcccggaagcgattctggagctggaa
cacatgggcctgccattctcccgtctggacgatggccgtatctatcaacgtccgtttggc
ggccagtcgaaaaacttcggcggcgagcaggcggcacgtactgcggcggcggctgaccgt
accggtcacgcactgctgcacacgctttatcagcagaacctgaaaaaccacaccactatt
ttctcggagtggtacgcgctggatctggtgaaaaacgctgacggcgcggtggtcggttgt
accgccctgtgcatcgaaaccggtgaagtggtttacttcaaagccaacgccaccgtgctg
gcgaccggcggtgcaggccgcatctatcagtccaccactaacgcgcatatcaacaccggt
gacggcgtcggtatggccctgcgtgccggtgtgccggtgcaggatatggaaatgtggcag
ttccacccaaccggtatcgccggtgcgggcgtgctggtgacagaaggctgccgtggtgaa
ggtggttacctgctgaacaaacacggcgagcgcttcatggagcgttatgcaccgaatgca
aaagacctggcgggtcgtgatgtggtggcgcgttccatcatgatcgaaatccgtgaaggt
cgcggctgcgacggtccgtggggcccgcacgcgaaactgaaactcgaccacctgggtaaa
gaagtgctggaatcccgtctgccgggcattcttgagctttctcgcaccttcgcccacgtc
gacccggttaaagagccaattccggtaatcccaacctgtcactacatgatgggcggtatt
ccgaccaaagtgaccggccaggcgctgaccgtgaacgagcagggtgaagatgtggtgatc
cctgggctgttcgcggtgggtgaaattgcctgcgtatccgtacacggcgctaaccgtctg
ggcggcaactcgctgctggacctggtcgtctttggccgtgcggcaggtctgcatctgcaa
gagtccattgccgagcagggcgcactgcgcgatgccaccgaagaagagattgacgcttcc
ctgcaacgtctgaatcgctggaatggcaaccgtgacggtgaagatccggttgaaatccgt
aaagcgcttcaggaatgcatgcagcataacttctcggtattccgtgaaggtgatgcgatg
gcgaaaggtcttgagcaactgaaagtcattcgtgagcgtctgaaaaatgcccgtctggac
gacacttccagcgaatttaacacccagcgtgttgagtgcctggagctggataacctgatg
gaaaccgcttacgcgactgctgtttccgcgaacttccgcaccgagagccgtggcgcgcat
agccgcttcgactatccggatcgtgacgacgcaaactggctgtgccattccctgtatctg
ccagagtctgagtccatgacgcgtcgtagcgtcaatatggaaccaaaactgcgtccggcg
ttcccgccgaagattcgtacttattaa

DBGET integrated database retrieval system