KEGG   Enterobacteriaceae bacterium FGI 57: D782_3228Help
Entry
D782_3228         CDS       T02431                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D782_3228
Enzymes [BR:ebf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     D782_3228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 NAD_binding_8 FAD_oxidored K_oxygenase Glutaredoxin FAD_binding_3 Thi4 FMO-like AlaDh_PNT_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AGB79164
UniProt: L0M5F6
LinkDB All DBs
Position
complement(3313223..3314788)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNQLAV
RKPSFLITNPGSHQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRNIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTYQNEITERNVMGVPAVFVNGQE
FGQGRMTLTEIVAKIDTGAEKRAAEELSTRDAYEVLIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSEYDVDVIDSQSASKLIPAAQEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGVVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLEYRDRVSGDTHQVELAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaacatgaaaacccagctcaaagcctatcttgaaaagctgaccaaacct
gttgagctgattgccacgctggatgacagcgccaaatcggcagaaatcaaggaactgctg
gctgagattgctgaactgtcagataaagtgaccttcaaagaagacaaccagcttgccgtt
cgtaaaccgtcgttcctgattaccaacccaggttcccatcagggcccgcgttttgctggc
tccccgctggggcatgagttcacctcactggttctggcgctgctgtggaccggcggtcat
ccgtcgaaagaagcgcagtctttgctggaacagatccgcaacatcgacggcgattttgag
ttcgaaacctattactcgctctcctgccacaactgcccggacgtggtgcaggcgctgaac
ctaatgagcgtgctgaacccgcgcatcaaacacacggcgatcgacggcggtacctatcag
aacgaaatcaccgaacgtaatgtgatgggtgttccggcagtattcgtgaatggtcaggag
tttggtcagggccgtatgacgctgacggaaatcgtggccaaaatcgatactggtgcggaa
aaacgcgcagcggaagagctgagcacccgtgatgcttatgaagtgctgatcgtgggttcc
ggcccatctggtgccgctgccgctgtctactcagcgcgtaaaggcatccgtaccggcctg
atgggcgagcgtttcggcggccaagtgctcgataccgttgatattgaaaactatatctcc
gtaccgaaaactgaaggccagaaactggctggcgccctgaaagctcacgtcagtgaatat
gatgttgatgtaattgacagccagagcgcatcgaagctgattccggcggcgcaggaaggt
ggcttacaccagattgaaaccgcgtctggcgccgtgctgaaagcgcgcagcatcatcatc
gcaaccggtgcaaaatggcgcaacatgaacgtgccgggcgaagatcagtatcgcaccaag
ggcgtaacctattgtccgcactgtgacggcccgctgtttaaaggtaaacgcgttgcggtt
atcggtggcggtaactccggcgtggaagcggcaattgatctggcgggcgtggttgaacac
gttacgctgctggaatttgccccggaaatgaaagcggatcaggttctgcaggataaagtc
cgcagcctgaaaaacgtcgatatcattctgaatgcgcaaaccacggaagtgaaaggcgac
ggcagcaaagtgaccggcctggaataccgtgaccgcgtaagcggtgatacgcatcaggtt
gaactggcggggatcttcgttcagattggcctgctgccgaacaccacctggctggaaggc
gcgatcgagcgtaaccggatgggtgaaatcatcatcgatgcgaaatgcgaaaccagcgtc
aaaggcgtctttgccgcgggtgactgcaccaccgttccgtacaaacagattatcatcgcc
gccggtgaaggcgcgaaagcgtcactcagcgcctttgattatctgattcgtacgaaaacg
gcataa

DBGET integrated database retrieval system