KEGG   Enterobacteriaceae bacterium FGI 57: D782_3476Help
Entry
D782_3476         CDS       T02431                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00730  Thiamine metabolism
ebf00790  Folate biosynthesis
ebf01100  Metabolic pathways
ebf02020  Two-component system
Module
ebf_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    D782_3476
   00790 Folate biosynthesis
    D782_3476
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    D782_3476
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ebf04147]
    D782_3476
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ebf00537]
    D782_3476
Enzymes [BR:ebf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     D782_3476
Exosome [BR:ebf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D782_3476
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ebf00537]
 Enzymes
  D782_3476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest IKI3
Motif
Other DBs
NCBI-ProteinID: AGB79405
UniProt: L0M9G9
LinkDB All DBs
Position
complement(3580278..3581690)
Genome map
AA seq 470 aa AA seqDB search
MKYSALFIALLPLLATPNIHAETTTAPALDSRAAQGDITAPGGARRLSGDQSAALRASII
DKPAKNIILLIGDGMGDSEITAARNYALGAGGFFKGIDALPLTGQYTHYALDKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEQPHQTLLELAKSAGLATGNVSTAELQDATPAA
QISHVTSRKCYGPSVTTEKCPTNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLISDASELASITVANQDKPLLGLFSDGNMPVRWEGPKASYHGN
IDKPVVTCTPNPKRNDSVPTLAQMTDKAITLLSSNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALAFAQKDGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEESMEHTGTQVRIAAYGPHAANVVGLTDQTDLYYTMKSALGL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacagcgcactctttattgccttattacctctgctggcaaccccgaatattcac
gccgaaaccacgactgcccccgcgcttgatagccgtgcggcgcagggtgatatcaccgcg
cccggtggcgcgcgtcgcctgagcggcgaccagtcggcggcgctgcgcgcgtcgattatt
gataaaccggccaaaaacattattttgctgattggcgatggcatgggtgattccgaaatt
accgccgcgcgcaactacgcgctgggcgcgggcggcttctttaaaggcattgatgcgctg
ccattaacgggccagtacacccattacgcgctggataagaaaacgggcaaaccggactac
gtcaccgattccgccgcctccgccaccgcatggagcaccggcgtgaaaacctacaacggc
gcgctgggcgtggatatccatgagcagccgcatcaaacgctgcttgagctggcaaaatcg
gcgggccttgcaaccggcaacgtctctaccgcggaattgcaggacgcgactccggcggca
cagatttctcacgtgacgtcgcgtaaatgctacggtccgagcgtaaccaccgaaaaatgc
ccgactaacgcgctggaaaaaggcggcaaaggctccattaccgagcaactgctgaacgcg
cgcgcagacgtcaccttaggtggtggcgcgaaaacctttgctgagaccgcaaccgcaggc
gaatggcagggcaaaaccctgcgtgagcaggcacaggcgcgcggttatcagttgataagc
gatgccagcgagctggcgagcattaccgtggcgaatcaggataaaccgctgctggggctg
ttttctgacggcaacatgccggtgcgctgggaagggccaaaagcatcctatcacggcaac
attgataaaccggtcgtaacctgtacgccgaacccgaaacgtaatgacagcgtgccgacg
ctggcgcagatgaccgacaaggccattacgctgctgagcagcaacgaaaaaggcttcttc
ctgcaggtggaaggcgcgtctatcgacaagcaggatcacgcggcgaatccgtgcgggcaa
attggtgaaacggtcgatctggacgaggccgtccagaaagcgctggcgttcgcacagaaa
gacggtaacacgctggtgatcgtcaccgctgaccacgcccacgccagtcagattgttgcg
ccggatactaaagcgccaggcctgacccaggcgctgaacaccaaagatggcgcggtcatg
gtgatgagctacggtaactcggaagaggaatcgatggagcataccggcactcaggtgcgc
attgccgcgtacggcccacatgcggcgaacgtcgttggcctgaccgatcagaccgatctc
tactacaccatgaagtccgcgcttggtctgtaa

DBGET integrated database retrieval system