KEGG   Enterobacter bugandensis: FAI37_00590Help
Entry
FAI37_00590       CDS       T05993                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ebg  Enterobacter bugandensis
Brite
KEGG Orthology (KO) [BR:ebg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FAI37_00590 (ahpF)
Enzymes [BR:ebg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FAI37_00590 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 NAD_binding_8 FAD_oxidored HI0933_like FAD_binding_3 Thi4 AlaDh_PNT_C K_oxygenase DAO Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: QCE26016
LinkDB All DBs
Position
complement(111911..113476)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPKVTFKEDNSLAV
RKPSFLITNPGSDKGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVYLNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYEVDVIDSQSASKLIPAAVEG
GLHQIETASGAVLKARSVIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIVLNAQTTEVKGD
GSKVTGLEYRDRVSGDVHSVQLSGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaatatgaaaacccagctcaaggcctaccttgagaaactgactaaaccc
gttgagctgattgccacgctggacgacagcgcgaaatcggcagaaatcaaagagctgctg
gcagagatcgctgaactgtcgccgaaagtgaccttcaaagaagacaattcgcttgcggtt
cgtaaaccctctttcctgattactaacccgggctcggacaagggaccgcgttttgccggc
tctccgctggggcatgaatttacctcactggtgctggcgctgctgtggaccggcggtcat
ccgtcaaaagaagcgcaggcgctgctggagcagatccgcgatatcgacggtgattttgag
tttgaaacctattactcgctctcctgccacaactgtccggacgtggtgcaggcgctgaac
ctgatgtcggttctgaacccgcgcatcaagcatacggcgattgacggcggtacgttccag
aatgagatcaccgatcgcaacgtgatgggtgttccggcggtgtatctgaacggtcaggag
ttcggccagggccgcatgacgctgacggaaatcgtcgcgaaagtggataccggcgcggaa
aaacgcgcggcggaagagctgaacaaacgcgatgcgtacgatgtgctgattgtcggttcc
ggccctgcgggcgctgcggcagcggtttactctgcacgtaaaggtattcgtaccggtctt
atgggcgaacgctttggcggacaggtgctggataccgtggacattgaaaactacatttcc
gtaccaaaaaccgaaggtcagaagctggccggtgcgctgaaggctcatgtcagcgattac
gaggtagatgtgatcgacagccagagcgccagcaagctgattccggcggcggtggaaggg
ggcttacaccagattgaaaccgcctctggcgcggtgctgaaagctcgcagcgtgatcgtt
gccaccggggcaaaatggcgcaacatgaatgttccgggcgaagatcaataccgtaccaaa
ggcgtgacctattgcccgcactgtgacggcccgctgtttaaaggcaaacgggtggcggtg
atcggcggcggtaactccggcgtggaagcggctatcgacctggcggggattgttgaacac
gtgacgctgctggagttcgcacctgagatgaaggccgaccaggtgctgcaggataaagtt
cgcagcctgaaaaacgtcgacatcgtgctgaacgcgcagaccacggaagtgaagggcgac
ggcagcaaagtgaccggtctggagtaccgtgaccgcgtaagcggcgatgttcacagcgtg
cagctttcggggatcttcgtacaaattggcctgctaccgaacaccacctggctggaaggc
gcgattgagcgcaaccgcatgggcgagattatcatcgatgcgaaatgtgaaaccagcgtg
aagggcgtgtttgccgcgggcgactgcaccaccgtgccgtacaagcagatcatcatcgcg
actggcgaaggtgcaaaagcgtccctgagcgcgtttgactacctgatccgcaccaaaacc
gcataa

DBGET integrated database retrieval system