KEGG   Enterobacter bugandensis: FAI37_10075Help
Entry
FAI37_10075       CDS       T05993                                 

Gene name
glnE
Definition
(GenBank) bifunctional [glutamate--ammonia ligase]-adenylyl-L-tyrosine phosphorylase/[glutamate--ammonia-ligase] adenylyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
ebg  Enterobacter bugandensis
Brite
KEGG Orthology (KO) [BR:ebg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FAI37_10075 (glnE)
Enzymes [BR:ebg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     FAI37_10075 (glnE)
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     FAI37_10075 (glnE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase
Motif
Other DBs
NCBI-ProteinID: QCE27747
LinkDB All DBs
Position
2066999..2069854
Genome map
AA seq 951 aa AA seqDB search
MPLSSQLQQHWQTVCERLPESLPASSLSEQAKSVLTFSDFVQESVSANPDWLAELESAPP
QADEWRHYAGWLQTALAEVADEATLMRVLRQFRRRVMVRIAWAQALELVSEESTLQQLSE
LAQTLIVAARDWLYAACCKEWGTPCSEEGVPQPLLILGMGKLGGCELNFSSDIDLIFAWP
ENGATRGGRRELDNAQFFTRLGQRLIKALDQPTQDGFVYRVDMRLRPFGDSGPLVLSFAA
LEDYYQEQGRDWERYAMVKARIMGDSDDAYANELCAMLRPFVFRRYIDFSVIQSLRNMKG
MIAREVRRRGLKDNIKLGAGGIREIEFIVQVFQLIRGGREPSLQSRSLLPTLSAIEQLHL
LPDGDAQTLREAYLFLRRLENLLQSINDEQTQTLPGDDLNRARLAWGMRVDDWSTLTERL
DAHMAGVRRIFNDLIGDDESESPDDALSEQWRELWQDALQEDDTTPVVAHLSDDARHRVV
ALIADFRLELNKRAIGPRGRQVLDHLMPHLLSDVCSREDAPVPLSRMMPLLSGIITRTTY
LELLSEFPGALKHLISLCAASPMVANKLARYPLLLDELLDPNTLYQPTATDAYRDELRQY
LLRVPEEDEEQQLEALRQFKQAQMLRVAAADIAGTLPVMKVSDHLTWLAEAIIDAVVHQA
WVQMVARYGQPKHLADREGRGFAVVGYGKLGGWELGYSSDLDLIFLHDCPADVMTDGERE
IDGRQFYLRLAQRIMHLFSTRTSSGILYEVDARLRPSGAAGMLVTSTDAFADYQKNEAWT
WEHQALVRARVVYGDPQLKTQFDAIRKSVMTTPREGSTLQTEVREMREKMRAHLGNKHRD
RFDIKADEGGITDIEFITQYLVLLHAHDKPKLTRWSDNVRILELLAQNDIMDEQEAQALT
RAYTTLRDELHHLALQEQPGHVALDCFTAERAQVTASWQKWLVEPCVTKQV
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgccgctttcttcgcagttacagcagcactggcaaaccgtttgcgaacgtctgcccgag
tcgttacccgcgtcatcgttaagcgagcaggcgaaaagcgtgctcacgttcagtgatttt
gtgcaggagagcgtcagcgccaatcctgactggctggcagagctggaaagcgcgccgccg
caggctgacgagtggcggcactatgctggctggctgcaaaccgcgctggcagaggtggcg
gatgaagccacgctgatgcgcgttctgcgtcagttccgccgccgggtgatggtgcgcatt
gcctgggcgcaggcgctggagctggtgagtgaagagagcaccttgcagcagctgagcgag
ctggcgcagacgctgattgtcgccgcgcgggactggctctacgccgcctgctgtaaagag
tggggcacgccgtgcagcgaagaaggggttccgcagccgctgttgattctggggatgggc
aagctgggcggctgcgagctgaacttctcctcggatatcgacctgatctttgcctggccg
gagaatggcgccacgcgaggcggtcgtcgcgagctggataacgcccagttctttacccga
ctcgggcagcgtctgattaaggcgctggatcagcctacgcaggacggctttgtttaccgc
gtggacatgcgcctgcgcccgtttggcgacagcggcccgctggtgctgagcttcgccgcg
ctggaagattattaccaggagcaggggcgcgactgggagcgttacgcgatggtcaaagcg
cggatcatgggcgacagcgacgacgcctacgccaacgagctgtgcgccatgctgcgcccg
ttcgtgttccgccgttacatcgactttagcgtgatccagtccctgcgcaatatgaaaggg
atgatcgcccgcgaggtgcgccgtcgcggcctgaaggacaacatcaagcttggcgcgggc
ggcatccgcgaaatcgaatttatcgttcaggtcttccagctgatccgcggcgggcgcgag
ccgtcgctgcagtcccgctcgctgctgccgacgctgagcgccattgagcaactgcatttg
ctgccggacggcgacgcgcaaaccctgcgcgaggcctatctgttcctgcgccgtctggaa
aacctgctgcaaagcattaacgacgaacagacccagaccctgccgggcgatgaccttaac
cgggcgcgcctggcctggggcatgcgggtggatgactggtcaacgttgaccgaacggctg
gatgcccatatggcaggcgtgcgccgcatctttaacgatcttattggtgacgacgaaagt
gaatcgccggacgatgcgctctccgagcaatggcgcgaactgtggcaggacgcgctccag
gaagatgacaccacgccggtggtggcgcacttaagcgacgacgcccgccatcgcgtggtg
gccttgattgccgatttccgccttgagctgaacaagcgcgccattgggccgcgcggtcgt
caggtgctggatcatctgatgccgcacctgctgagcgacgtctgctcccgcgaggatgcg
ccggtgccgctgtcgcgcatgatgccgctgctgagcgggattatcacgcgtaccacctac
ctggaactgctgagcgagtttcccggcgcgctgaaacacctgatttccctctgcgccgcg
tcgccgatggtagccaacaagctggcgcgatacccactgctgctggacgaactgcttgac
ccgaacacgctctatcagccgacggcgacggacgcctaccgcgacgagctgcgccagtat
ctgctgcgcgtgccggaagaggacgaagagcaacagctcgaggcgctgcgtcagtttaag
caggcccagatgctgcgcgtagcggcagcggatatcgccggtacgctgccggtaatgaaa
gtgagcgatcacttaacctggctggcggaggcgatcatcgacgcggtagtccaccaggcg
tgggtgcagatggtggcccgctatggccagccgaagcatcttgctgaccgcgaggggcga
gggtttgccgtggttggttacggcaagctgggcggctgggagctgggctacagctccgat
ctggatctgattttcctgcacgactgtccggcggacgtcatgaccgacggcgaacgtgag
attgacgggcggcagttctacctgcgcctggcccagcgcatcatgcacctgttcagcacc
cgcacttcgtcgggcattctgtacgaggtggacgcgcgcctgcgcccgtccggcgcggca
ggcatgctggtcacctcgacggacgcgtttgccgattatcagaagaacgaagcctggacg
tgggaacatcaggcgctggtgcgcgcccgcgtggtgtacggcgatccgcagctcaaaacg
cagttcgatgcgatccgcaagtcagtcatgacaaccccgcgcgagggcagcaccctgcaa
actgaagtgcgcgaaatgcgtgagaaaatgcgcgcgcatttgggcaacaaacatcgcgat
cgctttgatatcaaagccgatgagggcgggattaccgatattgagttcatcactcagtac
ctggtgctactgcacgcgcacgacaagccgaagctgacccgctggtccgataacgtgcgc
attctggaactgcttgcgcaaaacgacattatggacgagcaggaggcgcaggccttaacc
cgcgcctacaccacgctgcgcgatgaacttcatcacctggcgttgcaggagcagccgggc
cacgtggcgctggactgttttaccgcagagcgcgcccaggtgacggcaagctggcagaaa
tggctggtggagccgtgcgtaacaaaacaagtgtga

DBGET integrated database retrieval system