KEGG   Erwinia billingiae: EbC_01310Help
Entry
EbC_01310         CDS       T01270                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase isozyme I
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ebi  Erwinia billingiae
Pathway
ebi00010  Glycolysis / Gluconeogenesis
ebi00030  Pentose phosphate pathway
ebi00051  Fructose and mannose metabolism
ebi00052  Galactose metabolism
ebi00680  Methane metabolism
ebi01100  Metabolic pathways
ebi01110  Biosynthesis of secondary metabolites
ebi01120  Microbial metabolism in diverse environments
ebi01130  Biosynthesis of antibiotics
ebi01200  Carbon metabolism
ebi01230  Biosynthesis of amino acids
ebi03018  RNA degradation
Module
ebi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EbC_01310 (pfkA)
   00030 Pentose phosphate pathway
    EbC_01310 (pfkA)
   00051 Fructose and mannose metabolism
    EbC_01310 (pfkA)
   00052 Galactose metabolism
    EbC_01310 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    EbC_01310 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    EbC_01310 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ebi01009]
    EbC_01310 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ebi03019]
    EbC_01310 (pfkA)
Enzymes [BR:ebi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EbC_01310 (pfkA)
Protein phosphatases and associated proteins [BR:ebi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EbC_01310 (pfkA)
Messenger RNA biogenesis [BR:ebi03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EbC_01310 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CAX57662
UniProt: D8MKK6
LinkDB All DBs
Position
140863..141825
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALSEGLEVCGVYDGYLGLYEDRMANLDRYSVSD
MINRGGTFLGSARFPEFREESVRTVCIENMKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPEIPYTREELVEEIKAGIAKGKKHAIVAITEHICDIDELAKYIEAETK
RETRSTVLGHIQRGGAPVAYDRILASRMGAYSIELLLQGYGGRCVGIQNEKMVHHDIIDA
IENMKRPFKGDWLDTAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaatcggtgtactgacaagtggtggcgatgcgccaggaatgaacgcagcc
atccggggcgtggtacgtgccgccctgagcgaaggcctggaagtgtgtggcgtttacgat
ggctatctgggcctgtatgaagatcgcatggccaatctggaccgttacagcgtatctgac
atgattaaccgtggtggcaccttcctgggctccgcgcgtttcccggagttccgtgaagag
tcagtgcgtaccgtttgcatcgagaacatgaaaaagcgcgggattgatgcgctggtagtt
atcggtggtgatggttcttacatgggcgccaagcgtcttactgagatgggtttcccgtgc
atcggcttgccgggcaccattgataatgacgtggccggaacggattacaccatcggttac
ttcaccgcgctggaaaccgtcgtcgaagcgattgaccgtctgcgtgacacgtcttcttct
caccagcgtatttccatcgttgaagtgatgggccgttactgtggcgatctgacgctggct
gcggccatcgccggtggctgtgaatttatcgtattgcctgaaatcccttacacccgcgaa
gagctggtagaagagatcaaagcgggcatcgccaaaggtaaaaagcacgctatcgtggcc
attaccgagcacatctgcgatatcgatgagctggccaaatacattgaagctgaaaccaag
cgtgagacccgttcaacggtgctgggccatatccagcgcggcggtgcgccggtcgcttac
gaccgtatcctggcatcccgcatgggcgcctactcgattgagctgctgttgcagggctac
ggcggccgttgtgtcggtattcagaatgagaagatggtgcaccacgacatcatcgatgcg
attgaaaacatgaagcgtcccttcaaaggtgactggctggataccgccaagaagctttat
taa

DBGET integrated database retrieval system