KEGG   Erwinia billingiae: EbC_05790
Entry
EbC_05790         CDS       T01270                                 

Definition
(GenBank) OmpA family protein
  KO
K11892  type VI secretion system protein ImpK
Organism
ebi  Erwinia billingiae
Pathway
ebi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EbC_05790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ebi02044]
    EbC_05790
Secretion system [BR:ebi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EbC_05790
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: CAX58110
UniProt: D8MMQ3
LinkDB
Position
678646..679884
AA seq 412 aa
MQQQQAFAQGDVFSGASNNNPLVAAANGLLNSIPQIRHSVSHADPAALRQRLIDEMRQFE
MNCQRAGLAYEVIIGARYCLCTALDEAAALTPWGSRGVWPGQGLLVTFHNETWGGEKFFQ
LLAKLSQNPREQIVLLELINYCLQLGFEGRYRVLDNGRSQLETIKQRLLQMIHSVRGGYA
PPLSPHPEDHPVTRKLWRPVVPLWACTALVGFLACLFYILLNWRLGDVTSPVLAAVYQTP
LPEITIHNPAPPPPAALNLKAFLRPEIEQGLVAVKDEADQSVVTLKGDGLFTSASTSVRG
RYEEVLDRIAQAMNNVNGRILVIGYSDNVPIRSARFASNYELSLARAQSVQERLQQHLSQ
PQRVKAEGRGESNPLVPNTTAENRARNRRVDITLLVSPQNTRAEVNGLQQGN
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgcagcaacaacaggcttttgcccagggcgatgtgttctcgggcgccagcaataacaat
cctctggtggccgcggcgaacgggttattaaattcgattccgcaaatccgccattcggtc
agccatgccgatccggccgcgttacgccagcgtttgatcgacgaaatgcgccagttcgag
atgaactgccagcgggccggactggcttatgaagtgattattggcgcgcgctactgctta
tgtaccgcactggatgaagccgctgcgctcacgccctggggcagtcgcggcgtctggccc
ggccagggattgctggtcaccttccacaatgaaacctggggcggcgagaagttcttccag
ctgctggccaaactttcacagaatccgcgtgaacaaatcgttctgctggagctgatcaac
tactgtctgcaactgggctttgaagggcgctatcgcgtgctggataacggccgttcccag
ctggaaaccatcaaacagcgcctgctgcagatgatccactccgtgcgcggtggctatgcg
ccgccgctttcaccgcatcctgaagatcatccggtcacgcgcaaattgtggcggccggtg
gtgcctttgtgggcctgcacggcgctggtcggcttcctcgcctgcctgttctatatcctg
ctgaactggcggctgggcgatgtcacctcgccggtgctggctgcggtctaccaaacgccg
ttaccggaaatcaccattcataacccggcaccgccgccgccagcggcgttgaaccttaag
gcgttcctgcgtcctgaaatcgaacagggcctggtggcggtaaaagatgaagccgaccaa
agcgtggtcacgctaaaaggcgacggtctgtttacctcggcgtccacctcggttcgcggg
cgttatgaagaggtgctggatcgtatcgctcaggcgatgaacaacgttaatggccgcatt
ctggtgattggctacagcgataacgtgccgatccgcagtgcgcgcttcgcctctaactat
gagctttcgctggccagggcacagtccgtgcaggagcgtctgcaacaacatctgtcacag
ccgcaacgcgtgaaagcggaagggcgcggagagagcaatcctctggtgccgaataccacc
gccgaaaatcgcgcccgcaatcgccgggtggacatcacgctgttagtttcgccgcagaac
acccgcgcggaagttaacggtttgcagcaaggaaattaa

DBGET integrated database retrieval system