KEGG   Erwinia billingiae: EbC_21600Help
Entry
EbC_21600         CDS       T01270                                 

Definition
(GenBank) Xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
ebi  Erwinia billingiae
Pathway
ebi00040  Pentose and glucuronate interconversions
ebi00051  Fructose and mannose metabolism
ebi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EbC_21600
   00051 Fructose and mannose metabolism
    EbC_21600
Enzymes [BR:ebi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     EbC_21600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: CAX59691
UniProt: D8MS84
LinkDB All DBs
Position
2437024..2438007
Genome map
AA seq 327 aa AA seqDB search
MSELKFATRLNSFSSGAHLYWPDLQGKPSVLQMIARAGTAKGLTHLDLNYPQHITSNIST
MRQAIADAGLAVNGMQMRWDAPQFKIGAFTNPDAKIRREAIELTKRGIDAGREFGSTLMT
LWMGQDGFDYCFQADYKKIWEDAVSAVREVADYAPDVDVSIEYKPNEPRAYSIFPNVTSC
LLAVEEAGSPNLGITLDFAHVLFANEIPAYAAAMVARRSRLLGLDLNDGWGKRDDGLMAG
SVNPRATLEFLWQMQRDGYKGAYYFDTFPDASGLDPVREAETNVLTVKRLLKLCDKLHEN
PALLDAISRQDAVSSQQIVNDIMLAKE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaactgaaattcgctacacgtctcaactctttttcatcgggagcgcatctgtac
tggcccgatctccagggcaaaccttcagttctgcagatgattgcccgtgccggcacggcg
aaaggcttaacccatctcgatcttaactatcctcagcatatcaccagcaatatcagcacc
atgcgtcaagctatcgccgatgccggactggcggtaaacggcatgcaaatgcgttgggat
gcaccgcaatttaagatcggtgccttcaccaatccggatgcaaaaattcgtcgtgaagcc
attgaactgaccaagcgcggcatcgatgccggccgtgaattcggctcgacgctgatgacc
ttatggatggggcaggatggttttgattactgtttccaggcggactataagaagatttgg
gaagacgccgtcagcgccgttcgtgaagttgcggactatgcaccggatgtcgacgtcagc
attgagtacaaaccgaatgagccgcgcgcctacagcattttccccaacgtcacctcctgc
ctgctggccgtggaagaagcgggaagcccaaatctcggcattacgctggacttcgcccac
gtgttattcgctaacgaaatcccggcttatgcagcggcgatggttgcccgccgctcgcgc
ctgttagggttggatctcaatgatggctgggggaaacgtgacgatggcctgatggccggt
tcggtaaacccccgggcaacgctggagttcctctggcagatgcagcgcgatggctataag
ggcgcttactatttcgataccttcccggatgccagtggcctggatccggtccgtgaagca
gaaaccaatgtgcttaccgtgaaacgtctgctgaagttatgcgacaagcttcacgagaat
cctgcattgctggacgccatcagccgtcaggatgcggtcagctcacaacagattgtgaac
gacattatgctggctaaagagtag

DBGET integrated database retrieval system