KEGG   Erwinia billingiae: EbC_30810Help
Entry
EbC_30810         CDS       T01270                                 

Definition
(GenBank) Aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ebi  Erwinia billingiae
Pathway
ebi00220  Arginine biosynthesis
ebi00250  Alanine, aspartate and glutamate metabolism
ebi00290  Valine, leucine and isoleucine biosynthesis
ebi01100  Metabolic pathways
ebi01110  Biosynthesis of secondary metabolites
ebi01130  Biosynthesis of antibiotics
ebi01210  2-Oxocarboxylic acid metabolism
ebi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EbC_30810
   00290 Valine, leucine and isoleucine biosynthesis
    EbC_30810
   00220 Arginine biosynthesis
    EbC_30810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ebi01007]
    EbC_30810
Enzymes [BR:ebi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     EbC_30810
    2.6.1.66  valine---pyruvate transaminase
     EbC_30810
Amino acid related enzymes [BR:ebi01007]
 Aminotransferase (transaminase)
  Class I
   EbC_30810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CAX60612
UniProt: D8MUV5
LinkDB All DBs
Position
3459344..3460558
Genome map
AA seq 404 aa AA seqDB search
MNPIEKSSKLDNVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPSAQGYCDSKGLYSARKAIVQHYQARGMRDMTVEDVYIGNGVSELIVQSMQALLNMGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESAGWFPDLDDIRSKITPRTRGIVIINPNNP
TGAVYSKELLMEVVEIARQHNLIIFADEIYDKILYDAAQHHSIATLAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
VPGGRLYEQRNRAWELINEIPGVSCVKPDGALYMFPKIDAKKFNLHDDQKMVLDFLLQEK
VLLVQGSAFNWPYPDHVRIVTLPHVNDLEMAISKFGRFLEGYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaattgaaaaatcaagcaaactggataacgtgtgttacgacatccgtggaccg
gtgttaaaagaagcaaagcgtcttgaagaagaaggcaataaggtccttaagctgaatatc
ggcaatccagcgccgtttggttttgaagcccccgatgagatcctggtagatgtgatccgt
aatctgccgagcgcgcagggttattgtgattcaaaaggcctttactccgcccggaaagcc
atcgttcagcattatcaggcgcgcggtatgcgcgacatgaccgtggaagatgtctatatc
ggcaacggcgtttccgaactgatcgtgcagtcgatgcaggcgttgctgaatatgggcgac
gagatgctggttccggcaccggattacccactgtggaccgcagccgtgtctctttccagc
ggcaaagcggtgcattacctctgtgacgaatccgccggctggttcccggacctcgacgat
attcgcagtaaaatcaccccacgcacccgtggcatcgtgattattaaccccaataacccg
accggtgcggtttacagcaaagagctgttgatggaagtggtggaaatcgcacgtcagcat
aatttgattatttttgctgatgagatctacgacaaaatcttgtacgacgcggcacagcat
cattctattgccacgctggcccccgacctgctgaccatcacctttaacggcctgtccaaa
acctatcgcgtggccggtttccgccagggttggatggtgttgaatggcccgaagaagcac
gcaaaaggctatatcgaaggtctggaaatgctggcatccatgcgtctgtgcgccaacgtg
cctgcacagcatgcgattcagacggcattaggcggctaccagagcatcagcgagtttatc
gtccctggcggtcggctctatgagcagcgcaaccgggcatgggaattgatcaatgagatt
ccaggcgtcagctgcgttaagcctgacggcgcgctgtatatgttcccaaaaattgacgcc
aagaagttcaatctgcacgacgaccagaaaatggtgctggacttcctgctgcaggaaaaa
gtgctgctggttcagggctccgcctttaactggccgtatccggaccatgtccgaatcgtc
accctgcctcacgttaacgatctggaaatggccatcagcaagtttggtcgcttcctcgaa
ggttaccgtcagtaa

DBGET integrated database retrieval system