KEGG   Erwinia billingiae: EbC_43920Help
Entry
EbC_43920         CDS       T01270                                 

Gene name
bcsA
Definition
(GenBank) Cellulose synthase operon catalytic protein [UDP-forming]
  KO
K00694  cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
ebi  Erwinia billingiae
Pathway
ebi00500  Starch and sucrose metabolism
ebi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EbC_43920 (bcsA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ebi01003]
    EbC_43920 (bcsA)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ebi02000]
    EbC_43920 (bcsA)
Enzymes [BR:ebi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     EbC_43920 (bcsA)
Glycosyltransferases [BR:ebi01003]
 Polysaccharide
  Structural polysaccharide
   EbC_43920 (bcsA)
Transporters [BR:ebi02000]
 Other Transporters
  Others
   EbC_43920 (bcsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_trans_2_3 Glyco_tranf_2_3 Cellulose_synt Glyco_transf_21 PilZ
Motif
Other DBs
NCBI-ProteinID: CAX61923
UniProt: D8ML95
LinkDB All DBs
Position
complement(4872810..4875404)
Genome map
AA seq 864 aa AA seqDB search
MTPLRWLLNPPVWQALHQRYSGFRHHGASSLTSALHCLWLVLGWSLLRFESPAWQKVQAD
RRRLYPHISPEKPRPADLLRYLFQSLWLMLVLPVGAVSRSERSRIIPLQRWRQRALIWLG
RLPQRAEDRQLARKADRCIKQMPAALRKGLFGLAILLATALALLCISQPFDFFTQAVFVV
LLWSVAMVVRRIPGRLPTMMLIVLSLTISCRYLWWRYTSTLNWDDPVSLTFGVLLIAAET
YSWVVLVLGYFQTLWPLQRQPVPMPADTASWPSIDLLVPTYNEALSVVKPTLYAALGIDW
PKDKLTIYLLDDGNREEFRQFAAEIGIKYIARSGNAHAKAGNINHALKSECRSEYVAIFD
CDHVPTRSFLQVSLGWFLKDPKLAMLQTPHHFFSPDPFERNLGRFRRTPNEGTLFYGLVQ
DGNDVWDAAFFCGSCAVIRRSALDEIGGIAVETVTEDAHTSLRLHRKGYTSAYIRIPQAA
GLATESLSAHIGQRIRWARGMVQIFRLDNPLMGKGLKLVQRLCYANAMLHFLAGIPRLIF
LLAPLAFLLFHAFIIFAPALVIAIFVLPHMVHTSMTNSRIQGRWRHSFWSEVYETVLAWY
IARPTTVALFNPHKGKFNVTAKGGLVEEQHLDWVITKPYMCLVLINLAGVFAAFWRLHYG
PPHEVLTVIVSLVWVLYNMIILGGAVAVSVEARQIREAHRVEIAMPAALARADGHMLPCT
LRDYSDGGVGLELREDNLLSEGEQVWLLLRRGQQEFSFPCQVQRTFGRRAGIRLHQLTTE
QHVEFIQCTFARADTWALWQDSFPEDKPVQSLADIVVLGFKGYLRLAEYGPAPLRRLFAL
LTQLAGWLASFFPRSVSRTGSAVS
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccgttacgctggctgctgaatccgccggtctggcaggcgctgcatcaacgatac
agcggcttccgccatcacggtgcgtcatccctcacctccgccttgcactgcctgtggctg
gtgttgggctggtcgctgctgcgttttgagtcgccggcctggcaaaaggtgcaggccgat
cgccgtcgcctgtacccgcatatctcgccggaaaaaccgcgtccggcagacctgctgcgt
tatctttttcagagcctgtggctgatgctggtcttgccggtcggtgctgttagccgtagt
gagcgctcacgtattattccgctgcaacgctggcggcagcgcgccttaatctggctgggc
agactgccgcagcgcgcggaagaccgacagctggcgcgcaaggccgaccgctgcataaag
cagatgcctgctgcgctacgcaaagggctgtttggtttggcgatcctgctggcgaccgcg
ctggcgctgctgtgtatctctcagccgttcgacttctttacccaggcggtgtttgtggtg
ctgctgtggagcgtggcgatggtggtgcggcgcattccggggcgcttaccgaccatgatg
ctgatcgtactgtcgctgaccatctcctgccgctatctctggtggcgctacacctccacg
ctgaactgggatgacccggtcagcctgacctttggcgtgctgctgatcgcggcggaaacc
tattcgtgggtggtgctggtgctgggctatttccagaccctgtggccactgcagcgtcag
ccggtgccgatgcccgcagataccgccagctggccttcgatagatttgttagtacccact
tacaatgaagcgctgagcgtggtgaaaccgacgctgtatgcggcactcggcatcgactgg
ccgaaggacaaactgaccatttacctgctggatgatggcaaccgcgaagagttccgccag
ttcgccgcagagatcggcataaagtacattgcccggtccgggaatgcccatgccaaggcc
ggcaacatcaaccatgcgctgaagtccgaatgccgcagcgaatacgtggcgatttttgac
tgtgaccacgtgccaacccgctctttcctgcaggtgtcgctgggctggttcctgaaagat
ccgaagctggcgatgctgcagacgccgcaccacttcttctcgcccgatccgttcgaacgt
aacctgggccgcttccgccgcacgccgaatgaaggcaccctgttttacggcctggtgcag
gatggcaacgatgtctgggatgcggcgttcttctgcggctcctgtgcggtgatccgccgc
agcgcgctggatgaaattggcggcatcgcggtggagaccgtcaccgaagatgcgcacacc
tcgctgcggctgcaccgcaaaggctacacctcggcctatatccgtattccccaggcggcg
ggcctggcgaccgaaagcctgtccgcccatatcggccagcgtattcgctgggcgcgcggc
atggtgcagatcttccgtctggataacccgttgatgggcaaggggctgaagctggtgcag
cggctctgttatgccaacgccatgctgcacttcctcgccggtattccccggctgatcttc
ctgctggcaccgctggccttcctgctgttccacgcctttatcatttttgccccggcgctg
gtgatcgccatctttgtgctgccgcatatggtgcacaccagcatgaccaactcgcgcatt
cagggccgctggcgtcactcgttctggagcgaagtctatgaaaccgtgctggcctggtat
attgcccgtccaaccacggtggcgctgtttaatccgcacaaaggcaagttcaacgtcacc
gccaaaggcgggctggtggaagagcagcatctcgactgggtgatcaccaagccgtatatg
tgcctggtgctgatcaacctggcgggcgtgttcgccgccttctggcgactgcactatggc
ccgccgcacgaggtattgacggtgatcgtcagcctggtgtgggtgctctacaacatgatt
attctcggcggcgcggtggcggtgtcggtggaagcccggcagatccgtgaagcgcaccgg
gtggaaattgccatgccggcggcgctggcgcgggccgatggccatatgctgccctgcacg
ctgcgcgactactccgacggcggcgttggcctggagctgcgcgaagacaatctgctcagc
gaaggcgaacaggtctggctgctgctgcgccggggccagcaggagttcagcttcccgtgc
caggtgcagcgcacctttggccgccgcgccggcatccgcctgcatcagctgaccaccgaa
cagcacgtcgaatttattcaatgcacctttgcccgcgccgatacctgggccctgtggcag
gacagtttcccggaagataaaccggtgcaaagcctggccgatattgtggtactgggcttt
aaaggctatttgcggctggcagagtatggccctgcaccgctgcgccggctgtttgcgctg
ctgacgcagctggcaggctggctggcctccttcttcccccgcagcgtgagcagaacaggc
tccgcggtttcctga

DBGET integrated database retrieval system