KEGG   Erwinia billingiae: EbC_pEb10200450
Entry
EbC_pEb10200450   CDS       T01270                                 

Definition
(GenBank) conserved uncharacterized protein
Organism
ebi  Erwinia billingiae
SSDB
Other DBs
NCBI-ProteinID: CAX53323
UniProt: D8MJB3
LinkDB
Position
pEB102:complement(38394..39848)
AA seq 484 aa
MSQVKLKPATLALFIATVAISAQAADDNQSTEFGISLPSVNNSAIGYGKDVSGAVSDKLY
YTLGGGSVISQPATRSNMRKVGMSAGWSSDLMCGNFDLKTTVGNQLNGVTNGFKNLMGDV
VQNATGAVASLPAMIIQRANPGLYDMLTNGVLQANVSFDKAQLNCQNMSKRMMDFAGNNK
WTQGAVMDEYRSLVNSGDADAVRVNNSADKLQGNSGQNWIGGQKRGGQGQQAIRPTHDLT
AAGFNMMNSLPVLSADTVSSNSCNGGACGKYASAEEAAKAVVQVVGDSSLRTCTDASQCT
SGDDEQQPGATQAGTGFAPILEETTKENTEQLVKLVNGTEQPNAANLAKLKTGSLPITAG
VIRALQRDPDNAALTARLAGELSMADTVETALIMRRMIVTGMSEPNAAAQNAAIEEGDRR
VAAIDREITALRNEMELKRELSRNSVLTIIERENGRVNSNPQTQSDDSTDSRVNRLAVPE
TENN
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgtcacaagttaaattaaaaccagccacgcttgcactgttcatcgccacggtagcgata
tccgcgcaggcggccgacgataatcagtccactgagtttggaatctcactaccctccgtt
aataacagcgccataggctatggaaaagacgttagcggcgctgtttctgacaagctctat
tatacgctcggcggcgggtcggtaatttcacagccggcgacgcgcagcaacatgcgtaaa
gtcggtatgagtgctggttggagcagcgatctgatgtgcggtaatttcgaccttaaaaca
accgttggtaatcagctcaatggggtaacaaacggttttaaaaacctgatgggcgacgtg
gttcagaacgccaccggtgcagtagccagcctgccggcaatgattattcagcgtgctaat
cccggcctgtacgacatgctcacgaatggcgttctgcaggcaaatgtctcctttgataaa
gcacagctcaactgccagaacatgtccaagcgcatgatggattttgccggcaacaacaaa
tggacgcagggcgcggtaatggatgagtaccgatcactagttaacagcggagatgcagat
gctgtccgtgtgaataactcagcggacaagctgcagggtaattcaggccagaactggatt
ggtgggcagaagcgaggaggacaaggacagcaggctatacgaccaacccacgacctaacc
gctgcagggttcaatatgatgaacagcctgccggtactgagcgctgacacggtcagcagc
aacagctgcaacggcggtgcgtgtggaaaatatgccagcgcagaagaagcggctaaagcc
gtggtccaggtggtgggagacagctctctgcgcacctgcaccgatgcttcacagtgcacc
agtggtgatgacgaacagcagccgggcgcgacgcaggccggcaccggttttgcgcccatt
ctggaagagactacaaaagaaaacaccgagcagctggtaaaactggtgaacggcaccgag
cagcctaacgcagcgaatctggcaaagcttaaaaccggcagtttaccaattactgcagga
gttatcagagctctgcagagggatcctgacaatgcggccctgaccgcccgactcgccggt
gagctttcaatggctgacacggttgaaaccgcgctgatcatgcgccgcatgattgttacc
ggcatgtctgaacctaacgctgcggcacagaatgcggctattgaagaaggggacaggcgt
gttgcggccatcgatcgtgagatcacggcattgcgtaatgaaatggagcttaagcgcgag
ctgtcacgcaattctgtgctcaccatcatcgagcgggaaaacgggcgcgttaacagtaat
cctcagacgcagagcgatgacagcactgacagtcgcgttaatcgtctggccgtacctgaa
acggaaaacaactga

DBGET integrated database retrieval system