KEGG   Erwinia billingiae: EbC_pEb10200470
Entry
EbC_pEb10200470   CDS       T01270                                 

Definition
(GenBank) conserved uncharacterized protein
Organism
ebi  Erwinia billingiae
SSDB
Motif
Pfam: DUF1525 PLDc
Other DBs
NCBI-ProteinID: CAX53325
UniProt: D8MJB6
LinkDB
Position
pEB102:complement(40831..41226)
AA seq 131 aa
MRLRLLQSLFLFIPFQLLAGTVVYTDAEHPPQNLTEAASVVWLDGPDRLQDSIFGKLAAD
PQLAARQAREIFQSPQWDEQQEQIAQAYRQVVHAWEIGLHKFPAVVFDDRYVVYGTADVA
RAEMLRNRGGH
NT seq 396 nt   +upstreamnt  +downstreamnt
atgcgactcaggcttttgcaatcacttttcctatttataccgtttcagctactggctggc
accgttgtttataccgatgctgaacatccacctcagaatctgactgaagctgcttccgtt
gtctggcttgatggccccgaccgcctacaggattcaattttcggcaaactggctgcggat
cctcagttggccgcccggcaggcccgcgagatcttccagtcaccacaatgggacgagcag
caggagcagattgcacaggcgtaccggcaggtggtgcacgcatgggagattgggctacat
aaattccccgccgtcgttttcgacgatcggtatgtggtttatggcacagccgacgtagcc
cgcgctgagatgctacgcaatcgcggaggtcactga

DBGET integrated database retrieval system