KEGG   Escherichia coli BL21(DE3): ECD_00684Help
Entry
ECD_00684         CDS       T00931                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, FeS subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ebl  Escherichia coli BL21(DE3)
Pathway
ebl00020  Citrate cycle (TCA cycle)
ebl00190  Oxidative phosphorylation
ebl00650  Butanoate metabolism
ebl01100  Metabolic pathways
ebl01110  Biosynthesis of secondary metabolites
ebl01120  Microbial metabolism in diverse environments
ebl01130  Biosynthesis of antibiotics
ebl01200  Carbon metabolism
Module
ebl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ebl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ebl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECD_00684 (sdhB)
   00650 Butanoate metabolism
    ECD_00684 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ECD_00684 (sdhB)
Enzymes [BR:ebl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ECD_00684 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     ECD_00684 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: ACT42559
UniProt: A0A140NDZ9
LinkDB All DBs
Structure
PDB: 

Position
716259..716975
Genome map
AA seq 238 aa AA seqDB search
MRLEFSIYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETGSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgagttttcaatttatcgctataacccggatgttgatgatgctccgcgtatg
caggattacaccctggaagcggaagaaggtcgcgacatgatgttgctggatgcgcttatc
cagctgaaagagaaagatcccagcctgtcgttccgccgctcctgccgtgaaggtgtgtgc
ggttccgacggtctgaacatgaacggcaagaatggtctggcctgtattaccccgatttcg
gcactcaaccagccgggcaagaagattgtgattcgcccgctgccaggtttaccggtgatc
cgcgatttggtggtagacatgggacaattctatgcgcaatatgagaaaattaagccttac
ctgttgaataatggacaaaatccgccagctcgcgagcatttacagatgccagagcagcgc
gaaaaactcgacgggctgtatgaatgtattctctgcgcatgttgttcaacctcttgtccg
tctttctggtggaatcccgataagtttatcggcccggcaggcttgttagcggcatatcgt
ttcctgatcgatagccgtgataccgagactggcagccgcctcgacggtttgagcgatgca
ttcagtgtattccgctgtcacagcatcatgaactgcgtcagtgtatgtccgaaggggctg
aacccgacgcgcgccatcggccatatcaagtcgatgttgttgcagcgtaatgcgtaa

DBGET integrated database retrieval system