KEGG   Escherichia coli BL21(DE3): ECD_01097Help
Entry
ECD_01097         CDS       T00931                                 

Gene name
ptsG
Definition
(GenBank) fused glucose-specific PTS enzymes: IIB component/IIC component
  KO
K02778  PTS system, glucose-specific IIB component [EC:2.7.1.199]
K02779  PTS system, glucose-specific IIC component
Organism
ebl  Escherichia coli BL21(DE3)
Pathway
ebl00010  Glycolysis / Gluconeogenesis
ebl00520  Amino sugar and nucleotide sugar metabolism
ebl01100  Metabolic pathways
ebl02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ebl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECD_01097 (ptsG)
   00520 Amino sugar and nucleotide sugar metabolism
    ECD_01097 (ptsG)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ECD_01097 (ptsG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ebl02000]
    ECD_01097 (ptsG)
Enzymes [BR:ebl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.199  protein-Npi-phosphohistidine---D-glucose phosphotransferase
     ECD_01097 (ptsG)
Transporters [BR:ebl02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component
    ECD_01097 (ptsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC PTS_EIIB MscS_TM
Motif
Other DBs
NCBI-ProteinID: ACT42992
UniProt: A0A140N903
LinkDB All DBs
Structure
PDB: 

Position
1160436..1161869
Genome map
AA seq 477 aa AA seqDB search
MFKNAFANLQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPAVVSHVMAEAGGSVFANMP
LIFAIGVALGFTNNDGVSALAAVVAYGIMVKTMAVVAPLVLHLPAEEIASKHLADTGVLG
GIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLAAIFTGVVLSFIWPPIGSAIQ
TFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTNAAGQVFHGDIPRY
MAGDPTAGKLSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPI
EFSFMFVAPILYIIHAILAGLAFPICILLGMRDGTSFSHGLIDFIVLSGNSSKLWLFPIV
GIGYAIVYYTIFRVLIKALDLKTPGREDATEDAKATGTSEMAPALVAAFGGKENITNLDA
CITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRNH
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagaatgcatttgctaacctgcaaaaggtcggtaaatcgctgatgctgccggta
tccgtactgcctatcgcaggtattctgctgggcgtcggttccgcgaatttcagctggctg
cccgccgttgtatcgcatgttatggcagaagcaggcggttccgtctttgcaaacatgcca
ctgatttttgcgatcggtgtcgccctcggctttaccaataacgatggcgtatccgcgctg
gccgcagttgttgcctatggcatcatggttaaaaccatggccgtggttgcgccactggta
ctgcatttacctgctgaagaaatcgcctctaaacacctggcggatactggcgtactcgga
gggattatctccggtgcgatcgcagcgtacatgtttaaccgtttctaccgtattaagctg
cctgagtatcttggcttctttgccggtaaacgctttgtgccgatcatttctggcctggct
gccatctttactggcgttgtgctgtccttcatttggccgccgattggttctgcaatccag
accttctctcagtgggctgcttaccagaacccggtagttgcgtttggcatttacggtttc
atcgaacgttgcctggtaccgtttggtctgcaccacatctggaacgtacctttccagatg
cagattggtgaatacaccaacgcagcaggtcaggttttccacggcgacattccgcgttat
atggcgggtgacccgactgcgggtaaactgtctggtggcttcctgttcaaaatgtacggt
ctgccagctgccgcaattgctatctggcactctgctaaaccagaaaaccgcgcgaaagtg
ggcggtattatgatctccgcggcgctgacctcgttcctgaccggtatcaccgagccgatc
gagttctccttcatgttcgttgcgccgatcctgtacatcatccacgcgattctggcaggc
ctggcattcccaatctgtattcttctggggatgcgtgacggtacgtcgttctcgcacggt
ctgatcgacttcatcgttctgtctggtaacagcagcaaactgtggctgttcccgatcgtc
ggtatcggttatgcgattgtttactacaccatcttccgcgtgctgattaaagcactggat
ctgaaaacgccgggtcgtgaagacgcgactgaagatgcaaaagcgacaggtaccagcgaa
atggcaccggctctggttgctgcatttggtggtaaagaaaacattactaacctcgacgca
tgtattacccgtctgcgcgtcagcgttgctgatgtgtctaaagtggatcaggccggcctg
aagaaactgggcgcagcgggcgtagtggttgctggttctggtgttcaggcgattttcggt
actaaatccgacaacctgaaaaccgagatggatgagtacatccgtaaccactaa

DBGET integrated database retrieval system