KEGG   Escherichia coli BL21(DE3): ECD_01143Help
Entry
ECD_01143         CDS       T00931                                 

Gene name
ycgG
Definition
(GenBank) putative membrane-anchored cyclic-di-GMP phosphodiesterase
Organism
ebl  Escherichia coli BL21(DE3)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EAL CSS-motif
Motif
Other DBs
NCBI-ProteinID: ACT43037
LinkDB All DBs
Position
1205487..1207010
Genome map
AA seq 507 aa AA seqDB search
MRNTLIPILVAICLFITGVAILNIQLWYSAKAEYLAGARYAANNINHILEEASQATQTAV
NIAGKECNLEEQYQLGTEAALKPHLRTIIILKQGIVWCTSLPGNRVLLSRIPVFPDSNLL
LAPAIDTVNRLPILLYQNQFADTRVLVTISDQHIRGALNVPLKGVRYVLRVADDIIGPTG
DVMTLNGHYPYTEKVHSTKYHFTIIFNPPPLFSFYRLIDKGFGILIFILLIACAAAFLLD
RYFNKSATPEEILRRAINNGEIVPFYQPVVNGREGTLRGVEVLARWKQPHGGYISPAAFI
PLAEKSGLIVPLTQSLMNQVARQMNAIASKLPEGFHIGINFSASHIISPTFVDECFNFRD
SFTRRDLNLVLEVTEREPLNVDESLVQRLNILHENGFVIALDDFGTGYSGLSYLHDLHID
YIKIDHSFVGRVNADPESTRILDCVLDLARKLSISIVAEGVETKEQLDYLNQNNITFQQG
YYFYKPVTYIDLVKIILSKPKVKVVVE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatacactcatacccatcctcgttgcgatatgcttgtttattaccggtgtcgct
attttgaacatccagctctggtattccgcaaaagcagagtacctggcgggagcgagatat
gccgccaacaatatcaatcatatacttgaagaagcgtcacaagcgactcaaacagcggtt
aacattgccgggaaggaatgcaacctcgaggagcaatatcagcttggcactgaagcagct
ctgaaacctcacctgcgcacaatcatcattctcaaacagggaatagtctggtgtacatcc
ctgcctgggaatcgggtcctgttgtctcgtattcctgttttcccggacagtaatttactg
ttggctccagcaatcgacaccgttaatagattacctatcctgctctatcagaaccaattt
gcagatacgcgcgttttggttacgataagcgatcagcatattcgtggggcacttaatgta
cccttgaaaggggtaaggtatgtattacgcgtggcggatgacattattggaccaacgggt
gatgtgatgacgcttaatggacattatccctataccgagaaggttcactccacaaaatat
catttcactattatctttaacccgccgccactctttagcttctacagacttatcgataaa
ggctttgggattttaatatttattctgttaatcgcctgcgccgctgccttcctgcttgat
agatatttcaataaaagcgcaacgcctgaagagatcctgcgacgggcaataaataatggg
gagatcgtccctttttaccaacctgtggtaaatggtcgggaagggacattgcggggagtt
gaggtgttagcccgctggaaacaacctcacggtggatatatatcacccgcggcatttatt
ccacttgctgaaaaatccggattaatcgttccgcttacgcaaagcctgatgaatcaggtt
gccagacagatgaacgctatcgcgagtaaattgccggaaggttttcatattggaattaat
tttagcgcttcgcatattatttcgccgacgtttgtcgacgagtgtttcaatttccgtgac
agttttacccgccgcgatttaaaccttgttctggaagtcaccgagcgtgagccattgaat
gttgatgaaagtctggttcagcggttgaacatactgcatgaaaatggttttgtcatcgcg
ctggatgatttcggtactggctactcagggctttcttatcttcatgacctgcatattgat
tatatcaaaattgatcacagtttcgttggccgcgtaaacgcagacccagaatcaacccga
attctggattgtgtattggatctggcgcgtaaactttcgatcagtatcgtcgctgaaggt
gtcgaaacgaaagaacaacttgactatctgaaccaaaataatatcacatttcagcagggt
tattatttctataaacctgttacatacatcgacctggtcaaaattatcctttctaaaccg
aaggtgaaggttgtggttgagtga

DBGET integrated database retrieval system