KEGG   Escherichia coli BL21(DE3): ECD_01612Help
Entry
ECD_01612         CDS       T00931                                 

Gene name
slyA
Definition
(GenBank) global transcriptional regulator
  KO
K06075  MarR family transcriptional regulator, transcriptional regulator for hemolysin
Organism
ebl  Escherichia coli BL21(DE3)
Brite
KEGG Orthology (KO) [BR:ebl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ebl03000]
    ECD_01612 (slyA)
Transcription factors [BR:ebl03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    ECD_01612 (slyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 HTH_Crp_2 HTH_20 B-block_TFIIIC HxlR HTH_5 HTH_24 TrmB HTH_36 LexA_DNA_bind Replic_Relax DUF4423 GntR RP-C GlnD_UR_UTase DUF2250 RsbU_N Fe_dep_repress
Motif
Other DBs
NCBI-ProteinID: ACT43470
UniProt: A0A140NBY1
LinkDB All DBs
Position
complement(1665586..1666020)
Genome map
AA seq 144 aa AA seqDB search
MESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQ
PSLVRTLDQLEEKGLISRQTCASDRRAKRIKLTEKAEPLISEMEAVINKTRAEILHGISA
EELEQLITLIAKLEHNIIELQAKG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
ttggaatcgccactaggttctgatctggcacggttggtgcgcatatggcgtgctctgata
gaccatcgcctgaaaccgctggagttaacacaaacccattgggttacgttacacaatatc
catcagttacctccagaccagtcgcaaattcaactggcaaaagcgattggcatcgagcag
ccatcactggtccgtactctggaccaactggaagaaaaagggttaatttcgcgtcaaact
tgtgccagcgatcgtcgggctaaacgtattaaactgacggaaaaggcagagccgctgatc
agcgaaatggaagctgttattaacaaaacccgcgcggaaatattacatggcatctccgca
gaggaactggagcaactgattacgctcatcgcaaaacttgagcataatatcattgagtta
caggccaaagggtga

DBGET integrated database retrieval system