KEGG   Escherichia coli BL21(DE3): ECD_01942
Entry
ECD_01942         CDS       T00931                                 

Gene name
vioA
Definition
(GenBank) VioA, involved in dTDP-N-acetylviosamine synthesis
  KO
K20429  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
ebl  Escherichia coli BL21(DE3)
Pathway
ebl00541  O-Antigen nucleotide sugar biosynthesis
Brite
KEGG Orthology (KO) [BR:ebl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    ECD_01942 (vioA)
Enzymes [BR:ebl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     ECD_01942 (vioA)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP SelA Beta_elim_lyase SHMT
Other DBs
NCBI-ProteinID: ACT43793
LinkDB
Position
complement(2006072..2007184)
AA seq 370 aa
MNDKTIPVTQPSLPELAEFMPYLEKIWKNKWLTNNGPFHQELEEKLCEFLGVQHISLFNN
ATIALITALQALRITGEVITTPYSFVATSHAILWNGLTPVFVDIENDGYNIDYRKIEQAI
TPKTSAILPVHCYSTPCEVEEIQKIADNYGLKVIYDAAHAFGVNFKGQSLLNYGDLSILS
FHATKVFNTFEGGAIISPDAKTKLRIDRLKNFGIADELTVTAPGINGKMSEINAAFGLVQ
LKHIEGSISKRKIIDSLYRNLLKGTPGITIFPGNINANSNYSYFPILIDDGFHMSRDQAY
ELLKKNNILSRKYFYPLISNMPMYRGLISASVDNLPIANSVADKVLCLPIYTDLNEEIVV
KITKLLLGKM
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaacgataaaactattccagtaacgcaaccttctttgccggaacttgcagaattcatg
ccttacctggaaaaaatatggaaaaataaatggttgacaaataatggaccatttcatcaa
gaactcgaggaaaaattatgtgaatttttgggtgtgcagcatatctcgctttttaacaat
gcaacaattgcattgatcacagcattacaagccctaagaataacaggtgaggtaataaca
acaccatattcatttgttgcaacttcacatgctattttatggaatggacttacgcctgtc
tttgttgatattgaaaatgatggatataatattgattacagaaaaatagaacaggctatt
acaccaaaaacttcagcaattttacctgtccattgctactcaacaccctgtgaagtcgaa
gaaattcaaaaaatagctgataattatggattgaaagtaatctacgacgcagcacatgca
ttcggtgtaaattttaaagggcaaagtttacttaactatggtgatttatcaattcttagt
ttccatgcgacgaaagtcttcaatacatttgaaggtggggcaataattagccctgatgct
aaaaccaagttacgtatagatcgattaaaaaactttggtatcgccgacgagctgactgtg
acagctccaggaataaatggcaaaatgagtgaaattaatgctgcctttggacttgttcag
ttaaagcatattgagggctcaatatctaagcgaaaaataattgatagtctttaccggaat
ttactgaaagggactccgggtattactatatttccaggaaatataaatgcaaatagcaac
tattcatattttcctatactcatagatgatggttttcatatgagtcgtgatcaggcatat
gaattacttaagaaaaataatatcctatctcgaaagtatttttatccattaatcagtaat
atgcctatgtatcgaggattgatttcagctagcgttgataatctaccaatagccaatagt
gttgctgataaagtcctatgcttgccaatatatacagatttaaatgaagagattgttgtg
aaaataaccaaattattattgggtaagatgtga

DBGET integrated database retrieval system