KEGG   Escherichia coli BL21(DE3): ECD_02488Help
Entry
ECD_02488         CDS       T00931                                 

Gene name
pheA
Definition
(GenBank) chorismate mutase and prephenate dehydratase, P-protein
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
ebl  Escherichia coli BL21(DE3)
Pathway
ebl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ebl01100  Metabolic pathways
ebl01110  Biosynthesis of secondary metabolites
ebl01130  Biosynthesis of antibiotics
ebl01230  Biosynthesis of amino acids
Module
ebl_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
ebl_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:ebl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECD_02488 (pheA)
Enzymes [BR:ebl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     ECD_02488 (pheA)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     ECD_02488 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 WWE
Motif
Other DBs
NCBI-ProteinID: ACT44307
UniProt: A0A140N7E7
LinkDB All DBs
Structure
PDB: 

Position
2604259..2605419
Genome map
AA seq 386 aa AA seqDB search
MTSENPLLALREKISALDEKLLALLAERRELAVEVGKAKLLSHRPVRDIDRERDLLERLI
TLGKAHHLDAHYITRLFQLIIEDSVLTQQALLQQHLNKINPHSARIAFLGPKGSYSHLAA
RQYAARHFEQFIESGCAKFADIFNQVETGQADYAVVPIENTSSGAINDVYDLLQHTSLSI
VGEMTLTIDHCLLVSGTTDLSTINTVYSHPQPFQQCSKFLNRYPHWKIEYTESTSAAMEK
VAQAKSPHVAALGSEAGGTLYGLQVLERIEANQRQNFTRFVVLARKAINVSDQVPAKTTL
LMATGQQAGALVEALLVLRNHNLIMTRLESRPIHGNPWEEMFYLDIQANLESAEMQKALK
ELGEITRSMKVLGCYPSENVVPVDPT
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacatcggaaaacccgttactggcgctgcgagagaaaatcagcgcgctggatgaaaaa
ttattagcattactcgcagagcggcgcgaactggccgtcgaggtgggaaaagccaaactg
ctctcgcatcgcccggtacgtgatattgatcgtgaacgcgatttactggaaagattaatt
acgctcggtaaagcgcaccatctggacgcccattacattactcgcctgttccagctcatc
attgaagattccgtattaactcagcaggctttgctccaacaacatctcaataaaattaat
ccgcactcagcacgcatcgcttttctcggccccaaaggctcctattcacatcttgccgct
cgtcagtacgctgcccgtcactttgagcaattcattgaaagtggctgcgccaaatttgcc
gatatttttaatcaggtggaaaccggccaggccgactatgccgtcgtaccgattgaaaat
accagctccggtgccataaacgacgtttacgatctgctgcaacataccagcttgtcgatt
gttggcgagatgacgttaactatcgaccattgtttgttggtctccggcactactgattta
tccaccatcaatacggtctacagccatccgcagccattccagcaatgcagcaaattcctt
aatcgttatccgcactggaagattgaatataccgaaagtacgtctgcggcaatggaaaag
gttgcacaggcaaaatcaccgcatgttgctgcgttgggaagcgaagctggcggcactttg
tacggtttgcaggtactggagcgtattgaagcaaatcagcgacaaaacttcacccgattt
gtggtgttggcgcgtaaagccattaacgtgtctgatcaggttccggcgaaaaccacgttg
ttaatggcgaccgggcaacaagccggtgcgctggttgaagcgttgctggtactgcgcaac
cacaatctgattatgacccgtctggaatcacgcccgattcacggtaatccatgggaagag
atgttctatctggatattcaggccaatcttgaatcagcggaaatgcaaaaagcattgaaa
gagttaggggaaattacccgttcaatgaaggtattgggctgttacccaagtgagaacgta
gtgcctgttgatccaacctga

DBGET integrated database retrieval system