KEGG   Escherichia coli BL21(DE3): ECD_03434Help
Entry
ECD_03434         CDS       T00931                                 

Gene name
sgbU
Definition
(GenBank) putative L-xylulose 5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
ebl  Escherichia coli BL21(DE3)
Pathway
ebl00040  Pentose and glucuronate interconversions
ebl00053  Ascorbate and aldarate metabolism
ebl01100  Metabolic pathways
ebl01120  Microbial metabolism in diverse environments
Module
ebl_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:ebl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECD_03434 (sgbU)
   00053 Ascorbate and aldarate metabolism
    ECD_03434 (sgbU)
Enzymes [BR:ebl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     ECD_03434 (sgbU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 Glyco_hydro_114 UxuA Methyltransf_11 PRMT5_TIM
Motif
Other DBs
NCBI-ProteinID: ACT45233
UniProt: A0A140N658
LinkDB All DBs
Position
3611384..3612244
Genome map
AA seq 286 aa AA seqDB search
MRNHPLGIYEKALAKDLSWPERLVLAKSCGFDFVEMSVDETDERLSRLDWSTAQRTSLVA
AMIETGVGIPSMCLSAHRRFPFGSRDDAVRQRAREIMSKAIRLARDLGIRTIQLAGYDVY
YEDHDEGTRQRFAEGLAWAVEQAAASQVMLAVEIMDTAFMNSISKWKKWDEMLASPWFTV
YPDVGNLSAWGNDVPAELKLGIDRIAAIHLKDTQPVTEQSPGQFRDVPFGEGCVDFVGIF
KTLHKLNYRGSFLIEMWTEKAKEPVLEIIQARRWIEARMQEAGFIC
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaatcatccgttagggatttatgaaaaggcgctggcgaaagatctctcctggccg
gagcggctggtgctggcaaaaagctgcggttttgattttgtcgaaatgtcggtggatgaa
accgacgaacggctttcacgtcttgactggagcaccgcacaaaggacttcgctggttgcc
gcgatgatcgaaacgggtgttgggatcccgtcgatgtgcctgtccgcacatcgtcgcttt
ccttttggtagccgtgacgacgcggtacgccagcgagcacgggagatcatgagcaaagcg
attcgtctggcacgcgatctcggcatacgcaccatccagctggcgggctacgacgtctat
tacgaagaccacgatgaaggcacccggcaacgttttgctgaagggctggcgtgggcggtc
gaacaggcggcggcatcacaagtcatgctagcggtggagattatggacaccgcgtttatg
aactccatcagtaaatggaaaaagtgggacgagatgctcgcctcgccgtggttcaccgtc
tacccggacgtcggcaacctcagcgcctggggcaatgatgttcccgccgaactgaaactg
ggcattgaccgtatcgccgcgatccacctgaaagacacccagccagttaccgagcaaagt
cccggacagttccgcgacgtgccgtttggcgaaggctgcgtcgatttcgttggcatcttc
aaaacgctgcataaactgaactatcgcggttctttcctgattgagatgtggaccgaaaaa
gccaaagagccggtgctggagattattcaggcgcggcgttggattgaagcgcgtatgcag
gaggctggatttatatgttag

DBGET integrated database retrieval system