KEGG   Escherichia coli BL21(DE3): ECD_03856Help
Entry
ECD_03856         CDS       T00931                                 

Gene name
tufB
Definition
(GenBank) translation elongation factor EF-Tu 2
  KO
K02358  elongation factor Tu
Organism
ebl  Escherichia coli BL21(DE3)
Brite
KEGG Orthology (KO) [BR:ebl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ebl03012]
    ECD_03856 (tufB)
   03029 Mitochondrial biogenesis [BR:ebl03029]
    ECD_03856 (tufB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ebl04147]
    ECD_03856 (tufB)
Translation factors [BR:ebl03012]
 Eukaryotic Type
  Elongation factors
   ECD_03856 (tufB)
 Prokaryotic Type
   ECD_03856 (tufB)
Mitochondrial biogenesis [BR:ebl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ECD_03856 (tufB)
Exosome [BR:ebl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ECD_03856 (tufB)
  Exosomal proteins of breast cancer cells
   ECD_03856 (tufB)
  Exosomal proteins of colorectal cancer cells
   ECD_03856 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ACT45648
UniProt: A0A140NCI6
LinkDB All DBs
Structure
PDB: 

Position
4083995..4085179
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKILELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgcaatcactaccgtactggctaaaacctac
ggcggtgctgctcgcgcattcgaccagatcgataacgcgccggaagaaaaagctcgtggt
atcaccatcaacacttctcacgttgaatacgacaccccgacccgtcactacgcacacgta
gactgcccggggcacgccgactatgttaaaaacatgatcaccggtgctgctcagatggac
ggcgcgatcctggtagttgctgcgactgacggcccgatgccgcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgaaatggaagttcgtgaacttctgtctcag
tatgacttcccgggcgacgacactccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgacgcagagtgggaagcgaaaatcctggaactggctggcttcctggattcttacatt
ccggaaccagagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagaacgcggtatcatcaaagttggt
gaagaagttgaaatcgttggtatcaaagagactcagaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggcaccatcaag
ccgcacaccaagttcgaatctgaagtgtacattctgtccaaagatgaaggcggtcgtcat
actccgttcttcaaaggctaccgtccgcagttctacttccgtactactgacgtgactggt
accatcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtaccgttggcgcgggcgttgtagcaaaagttctgagctaa

DBGET integrated database retrieval system