KEGG   Escherichia coli BL21(DE3): ECD_03925Help
Entry
ECD_03925         CDS       T00931                                 

Gene name
alr
Definition
(GenBank) alanine racemase, biosynthetic, PLP-binding
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ebl  Escherichia coli BL21(DE3)
Pathway
ebl00473  D-Alanine metabolism
ebl01100  Metabolic pathways
ebl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ebl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ECD_03925 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    ECD_03925 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ebl01011]
    ECD_03925 (alr)
Enzymes [BR:ebl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ECD_03925 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ebl01011]
 Precursor biosynthesis
  Racemase
   ECD_03925 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACT45716
UniProt: A0A140NHE6
LinkDB All DBs
Structure
PDB: 

Position
4173191..4174270
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPVTVW
MKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAIFNT
FCEGKPGQRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMSLTSS
LIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYVD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaactgttgtgattaaccgccgcgctctgcgacacaacctgcaacgtctt
cgtgaactggcccctgccagtaaaatggttgcggtggtgaaagcgaacgcttatggtcac
ggtcttcttgagaccgcgcgaacgctccccgatgctgacgcctttggcgtagcccgtctc
gaagaagctctgcgactgcgtgcggggggaatcaccaaacctgtactgttactcgaaggc
ttttttgatgccagagatctgccgacgatttctgcgcaacattttcataccgccgtgcat
aacgaagaacagctggctgcgctggaagaggctagcctggacgagccggttaccgtctgg
atgaaactcgataccggtatgcaccgtctgggcgtaaggccggaacaggctgaggcgttt
tatcatcgcctgacccagtgcaaaaacgttcgtcagccggtgaatatcgtcagccatttt
gcgcgcgcggatgaaccaaaatgtggcgcaaccgagaaacaactcgctatctttaatacc
ttttgcgaaggcaaacctggtcaacgttccattgccgcatcgggtggcattctgctgtgg
ccacagtcgcattttgactgggtgcgcccgggcatcattctttatggcgtctcgccgctg
gaagatcgctccaccggtgccgattttggctgtcagccagtgatgtcactaacctccagc
ctgattgccgtgcgtgagcataaagccggagaacctgttggttatggtggaacctgggta
agcgaacgtgatacccgtcttggcgtagtcgcgatgggctatggcgatggttatccgcgc
gccgcgccgtccggtacgccagtgctggtgaacggtcgcgaagtaccgattgtcgggcgc
gtggcgatggatatgatctgcgtagacttaggtccacaggcgcaggacaaagccggggat
ccggtcattttatggggcgaaggtttgcccgtagaacgtatcgctgaaatgacgaaagta
agcgcttacgaacttattacgcgcctgacttcaagggtcgcgatgaaatacgtggattaa

DBGET integrated database retrieval system