KEGG   Escherichia coli BL21(DE3): ECD_04277Help
Entry
ECD_04277         CDS       T00931                                 

Gene name
arcA
Definition
(GenBank) response regulator in two-component regulatory system with ArcB or CpxA
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
ebl  Escherichia coli BL21(DE3)
Pathway
ebl02020  Two-component system
ebl02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:ebl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECD_04277 (arcA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    ECD_04277 (arcA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ebl02022]
    ECD_04277 (arcA)
Two-component system [BR:ebl02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   ECD_04277 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ACT46057
UniProt: A0A140NGG3
LinkDB All DBs
Structure
PDB: 

Position
complement(4556891..4557607)
Genome map
AA seq 238 aa AA seqDB search
MQTPHILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGK
NGLLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR
TMNLGTVSEERRSVESYKFNGWELDINSRSLIGPDGEQYKLPRSEFRAMLHFCENPGKIQ
SRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEIIATIHGEGYRFCGDLED
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccccgcacattcttatcgttgaagacgagttggtaacacgcaacacgttgaaa
agtattttcgaagcggaaggctatgatgttttcgaagcgacagatggcgcggaaatgcat
cagatcctctctgaatatgacatcaacctggtgatcatggatatcaatctgccgggtaag
aacggtcttctgttagcgcgtgaactgcgcgagcaggcgaatgttgcgttgatgttcctg
actggccgtgacaacgaagtcgataaaattctcggcctcgaaatcggtgcagatgactac
atcaccaaaccgttcaacccgcgtgaactgacgattcgtgcacgcaacctgctgtcccgt
accatgaatctgggtactgtcagcgaagaacgtcgtagcgttgaaagctacaagttcaat
ggttgggaactggacatcaacagccgttcgttgatcggccctgatggcgagcagtacaag
ctgccgcgcagcgagttccgcgccatgcttcacttctgtgaaaacccaggcaaaattcag
tctcgtgctgaactgctgaagaaaatgaccggccgtgagctgaaaccacacgaccgtact
gtagacgtgacgatccgccgtattcgtaaacatttcgaatctacgccggatacgccggaa
atcatcgccaccatccacggtgaaggttatcgcttctgtggtgatctggaagattaa

DBGET integrated database retrieval system