KEGG   Escherichia coli B REL606: ECB_00708Help
Entry
ECB_00708         CDS       T00944                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00010  Glycolysis / Gluconeogenesis
ebr00260  Glycine, serine and threonine metabolism
ebr00680  Methane metabolism
ebr01100  Metabolic pathways
ebr01110  Biosynthesis of secondary metabolites
ebr01120  Microbial metabolism in diverse environments
ebr01130  Biosynthesis of antibiotics
ebr01200  Carbon metabolism
ebr01230  Biosynthesis of amino acids
Module
ebr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ebr_M00002  Glycolysis, core module involving three-carbon compounds
ebr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECB_00708 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    ECB_00708 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECB_00708 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ebr04131]
    ECB_00708 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ebr04147]
    ECB_00708 (gpmA)
Enzymes [BR:ebr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ECB_00708 (gpmA)
Membrane trafficking [BR:ebr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ECB_00708 (gpmA)
Exosome [BR:ebr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ECB_00708 (gpmA)
  Exosomal proteins of melanoma cells
   ECB_00708 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ACT38390
LinkDB All DBs
Structure
PDB: 

Position
complement(767472..768224)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacttctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcattgcagggtctgaacaaa
gcggaaactgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaactattctgccgcgtatgaagagcggtgagcgcgtgatc
atcgctgcacacggtaactctttacgtgcgctggtgaaatatcttgataacatgagcgaa
gaagagattcttgagcttaatatcccgactggcgtgccgctggtgtatgagttcgacgag
aatttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcagcgaaagca
gcggcggttgcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system