KEGG   Escherichia coli B REL606: ECB_01578
Entry
ECB_01578         CDS       T00944                                 

Gene name
rstB
Definition
(GenBank) sensory histidine kinase in two-component regulatory system with RstA
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECB_01578 (rstB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ebr01001]
    ECB_01578 (rstB)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ebr02022]
    ECB_01578 (rstB)
Enzymes [BR:ebr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ECB_01578 (rstB)
Protein kinases [BR:ebr01001]
 Histidine kinases
  OmpR family
   ECB_01578 (rstB)
Two-component system [BR:ebr02022]
 OmpR family
  RstB-RstA
   ECB_01578 (rstB)
SSDB
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_3 HATPase_c_2
Other DBs
NCBI-ProteinID: ACT39242
LinkDB
Position
1660077..1661378
AA seq 433 aa
MKKLFIQFYLLLFVCFLVMSLLVGLVYKFTAERAGKQSLDDLMNSSLYLMRSELREIPPH
DWGKTLKEMDLNLSFDLRVEPLSKYHLDDISMHRLRGGEIVALDDQYTFLQRIPRSHYVL
AVGPVPYLYYLHQMRLLDIALIAFIAISLAFPVFIWMRPHWQDMLKLEAAAQRFGDGHLN
ERIHFDEGSSFERLGVAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSDNL
SAAESQALNRDISQLEALIEELLTYARLDRPQNELHLSEPDLPLWLSTHLADIQAVTPDK
TVRIKTLMQGHYAALDMRLMERVLDNLLNNALRYCHSTVETSLLLSGNKATLIVEDDGSG
IAPENREHIFEPFVRLDPSRGRSTGGCGLGLAIVHSIALAMGGTVNCGTSELGGARFSFS
WPLWHNIPQFTSA
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaaaaaattgtttatccagttttacctgttattgtttgtctgcttccttgtgatgtct
ctgctggttgggctggtgtacaaatttaccgccgaacgcgcgggcaaacagtcgctggat
gatttgatgaacagttcgctgtatctgatgcgcagcgaattgcgtgagatccccccacac
gactggggtaagacgctgaaagagatggatttaaatctctctttcgatctgcgtgtcgag
ccactgagtaaataccatcttgatgatatttccatgcaccgactgcgtggcggcgaaatt
gtcgccctggacgatcagtacacgtttttgcagcgtatcccgcgcagccactacgtgctg
gcagttggtcctgttccttatctttattacctccatcaaatgcgattgctggatatcgcc
ctgatcgcttttattgctatttccctcgcctttccggtgtttatctggatgcgtccgcac
tggcaggatatgttaaaactggaagcagcggcgcaacgatttggcgatgggcatctcaat
gaacgtatccactttgatgagggttcgagctttgaacgacttggcgtcgcatttaaccag
atggcggacaatatcaacgccttaattgccagcaaaaaacagcttattgacggtatcgct
cacgaactgcgaacaccgttagtgcgcctgcgttatcgactggagatgagcgataacctg
agcgccgccgaatcccaggcgttgaatcgtgatatcagtcaacttgaagctttaattgaa
gagctgctgacttatgcccgactcgatcgcccacaaaacgagcttcatcttagcgaacca
gacctgccgttgtggctgtcaacgcatctggcagatattcaggcagtaacgcccgataaa
acggtacggataaaaacgctcatgcaaggccattatgcggcgttggatatgcgcttaatg
gagcgcgtgctggataatttgctcaataacgccctgcgctactgccattcaacggttgaa
accagcctgctactgtcggggaataaagcgacattaattgttgaggatgatggctcaggg
attgccccagaaaaccgcgaacatatctttgaaccttttgttcgcctcgatcccagccgg
ggtcgctcaaccggcggctgcgggctgggactggcaattgtccactctatagcactggca
atgggcggtacggttaattgtggcaccagcgaactgggtggtgcccgcttctcgtttagc
tggccgttatggcataacatcccgcaatttacctctgcttga

DBGET integrated database retrieval system