KEGG   Escherichia coli B REL606: ECB_01743
Entry
ECB_01743         CDS       T00944                                 

Gene name
ydjJ
Definition
(GenBank) predicted oxidoreductase, Zn-dependent and NAD(P)-binding
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00040  Pentose and glucuronate interconversions
ebr00051  Fructose and mannose metabolism
ebr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECB_01743 (ydjJ)
   00051 Fructose and mannose metabolism
    ECB_01743 (ydjJ)
Enzymes [BR:ebr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     ECB_01743 (ydjJ)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 ADH_N_2 Cupin_2 ThiF
Other DBs
NCBI-ProteinID: ACT39404
LinkDB
Structure
PDB: 
5VM2

Position
complement(1835019..1836062)
AA seq 347 aa
MKNSKAILQVPGTMKIISAEIPVPKEDEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVRKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGALVEPAAVGMHAAMLADVKPGKKIIILGAGCI
GLMTLQACKCLGATEIAVVDVLEKRLAMAEQLGATVVINGAKEDTIARCQQFTEDMGADI
VFETAGSAVTVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVTIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYRDVQQAFEESVNNKRDIIKGVIKISD
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaaaattcaaaagcaatattgcaggtgccgggcacaatgaaaattatttcagcagaa
ataccagtgcctaaagaagatgaagttttgattaaagtagaatatgtcggtatttgtggt
tcagatgtacatggttttgaatcaggcccgtttattccgcctaaagacccaaatcaagaa
attggcctgggtcatgaatgcgccgggacggttgtggctgtgggaagccgcgtgcgcaaa
tttaaaccgggggatcgggtaaatatcgaacctggcgttccttgcggtcactgtcgttac
tgtctggaaggcaaatataacatctgcccggacgttgattttatggcgacacaacccaac
taccgcggcgcattaacgcactatctgtgtcatccggagagctttacttacaaactgccc
gacaatatggacacgatggaaggggcgctggtggagcctgccgcagtcgggatgcatgcc
gcgatgctggcagatgttaaaccgggtaagaagataattattctgggagcaggttgtatt
ggtttgatgacgttgcaagcgtgcaaatgcctgggagcaacggaaattgccgtcgttgat
gtgctggaaaaacgtctggcaatggcggaacagcttggtgcgacagtggttattaacggc
gcaaaagaagacactattgcacgctgtcagcaatttaccgaagacatgggcgcagatatt
gttttcgaaacagcgggttctgcggtcaccgttaaacaggcaccttatctggtaatgcgc
ggcggtaaaattatgattgttggtactgtacccggcgattcggcaatcaatttcctcaaa
atcaatcgcgaagtcactatccagacggtattccgctatgccaatcgttatccggtcacg
attgaagctatttcttcagggcgattcgatgtgaaatcgatggtgacacatatttacgat
tatcgggatgtacaacaggcatttgaagagtcagttaacaacaaacgcgacattattaaa
ggcgttattaagattagcgattaa

DBGET integrated database retrieval system